Oryctolagus cuniculus (rabbit): 103345648 Help Entry 103345648         CDS       T03373                                  Name (RefSeq) kinesin-like protein KIF2C   KO K10393   kinesin family member 2/24 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04814   Motor proteins Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103345648  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     103345648   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ocu04812]     103345648 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Motor proteins      103345648   Centrosome formation proteins    Spindle formation proteins     103345648 Cytoskeleton proteins [BR:ocu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Kinesins      103345648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fib_alpha DUF4168 Ada3 AAA_13 UPF0242 FUSC Motif Other DBs NCBI-GeneID:  103345648 NCBI-ProteinID:  XP_051693223 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search METEEMEASSKGARSASNFSNEEDELSSQVSSFNEATTQIRELEERAKEELKEIVQQGPG WLELSMMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKALRVAMQLEEQASRQISSK KRPQ NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggaaacagaagagatggaagccagctctaagggggcccggagtgcaagcaacttctcc aacgaagaggatgaactgtcttcccaggtgtccagctttaatgaagccacgacccagatc agggagctggaagagagggccaaggaagagctcaaggaaattgtgcagcaaggaccaggc tggcttgagctctccatgatgactgagcagccagattatgacctggagacttttgtgaac aaagcggaatctgccctggcccagcaagccaagcacttctcggctctgcgagatgtcatc aaggctttgcgtgtggccatgcagctggaagagcaggccagcagacagataagcagcaag aaacggccccagtga

DBGET integrated database retrieval system