KEGG   Oryctolagus cuniculus (rabbit): 103345667
Entry
103345667         CDS       T03373                                 
Symbol
TNFRSF12A
Name
(RefSeq) TNF receptor superfamily member 12A
  KO
K05149  tumor necrosis factor receptor superfamily member 12A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345667 (TNFRSF12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103345667 (TNFRSF12A)
   04090 CD molecules [BR:ocu04090]
    103345667 (TNFRSF12A)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103345667 (TNFRSF12A)
CD molecules [BR:ocu04090]
 Proteins
  103345667 (TNFRSF12A)
SSDB
Motif
Pfam: stn_TNFRSF12A DUF2207
Other DBs
NCBI-GeneID: 103345667
NCBI-ProteinID: XP_008248851
Ensembl: ENSOCUG00000027985
UniProt: G1TPB5
LinkDB
Position
Un
AA seq 80 aa
MDCASCPARPHSDFCLGCAAAPPAPFRLLWPILGGALSLVLVLGLLSAFLVWRRCRRREK
FTTPIEETGGEGCPGAALIQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atggactgcgcgtcgtgcccggcgcgaccacacagcgacttctgcctgggctgcgccgca
gcccctcccgcccccttccggctgctctggcccatcctggggggcgccctgagcctggtc
ctcgtgctggggctgctttctgccttcttggtctggagacggtgccgcaggagagagaaa
ttcaccacccccatagaggagaccggcggagagggctgtcccggagcggccctgatccag
tga

DBGET integrated database retrieval system