KEGG   Oryctolagus cuniculus (rabbit): 103345669
Entry
103345669         CDS       T03373                                 
Symbol
IL32
Name
(RefSeq) interleukin 32
  KO
K22632  interleukin 32
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345669 (IL32)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345669 (IL32)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   103345669 (IL32)
SSDB
Motif
Pfam: IL32 DUF4726 Glyco_trans_2_3
Other DBs
NCBI-GeneID: 103345669
NCBI-ProteinID: XP_008248854
LinkDB
Position
Un
AA seq 187 aa
MSGSSPAGWAPGHPSAMGYSQLPCDDIDTASYKMHKDLDRFISVAQGQHLRGEQLDESSL
ESLEDSINEVLLDNVESHFRNNLETIPLSSDMQLELRSRVKRPSGSGQRYEQLGGEQSRQ
SFWETLRRWFRAMLGRLQQRWQRALAWLQELVAAGVQALRSAVELVWRTLKRFRCSLMKW
LGLPLGV
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagcggctcctctccagcgggctgggctcctggacatccaagcgccatgggctactcc
cagttaccctgtgatgacattgacacagcctcgtacaagatgcacaaggacctggacaga
ttcatttctgttgcccaaggccaacatttaagaggtgaacagctggacgagtccagtctg
gagtcactggaggacagcatcaacgaggtcttgttggacaacgtagagagccactttcgt
aacaacctggagaccattcctttgtcttctgacatgcaactggagttgcgatctcgggtc
aagaggccgtcgggctctgggcagagatacgagcagttaggcggcgagcagtccaggcag
agcttctgggaaacgctgcggcggtggttccgggcaatgctgggccggctgcagcagcgc
tggcagcgtgcgttggcctggctgcaggagctggtggccgccggggtgcaggccttgcgc
agcgccgtcgagctcgtgtggcgcacactgaagcgtttccgctgctccctgatgaagtgg
cttgggctgccccttggggtctag

DBGET integrated database retrieval system