KEGG   Oryctolagus cuniculus (rabbit): 103347059
Entry
103347059         CDS       T03373                                 
Symbol
IL27RA
Name
(RefSeq) interleukin 27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103347059 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103347059 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103347059 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103347059 (IL27RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   103347059 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 103347059
NCBI-ProteinID: XP_017195886
Ensembl: ENSOCUG00000014513
LinkDB
Position
Un
AA seq 665 aa
QPFYAAAAAAPPPPPTPPVFSLGTPEGSAGTLQCHGVAPLGDLNCSWEPRGDRATPFLLH
LQSHYHPSRTYTVAVAAGQHWVTVPREELTASDKLRVWGSGAGRPLGPPISVNLDTRVKP
NVPQLWPDVDFSEGEPLDATVHWAAPTWPSHKVLICQFRYQKCLEQDWVLLEPELETIPL
SPLEIQDLELATSYRVSGRCRTQDEEDLWGEWSPSLSFQTLPSGGTSGLDPHIPCAQESV
SLIHSTTTTTTTLFLFFLAPKDVWVSGNLCGTPGAQDPLLLWTPPGSCLPVSYRVWFPEQ
EPPGEGVACCSVRIPAGAQWAAVSAVNATSWKPLTNLSLACLDSAPRGVVVSSAGSGELR
VSWRPPGSGEPQEYVVDWARDGEPLEKLTWARLPPRRLSALLAGNFTEGVPYRITVTAVS
PGGVAPAPPVWGFTQELAPVIGPALWRLRDDPPGTPAVAWAVVPRHQLRGHLTHYTVCAR
SGGRPLVCVNVNGSIWNITLPDLPRGPCELWVTASTTAGQGPPGPSLWLHLPDNSLGWKV
LPGVLSLWGLFFVGCGLALTLSGRCLHLRYKVLPRWLWEKVPDPANSQSGQPPTEEVPPV
QPPGDLAILEVEEMQPPPAPEPPQAAAAPLDCGYERHFLPTPEELGLLSVPHPGALDAPG
CRDLQ
NT seq 1999 nt   +upstreamnt  +downstreamnt
ccagcccttctacgccgccgccgccgccgcgccccctcccccacccacgccccccgtctt
cagcctggggacccccgagggcagtgcgggaacactgcagtgccatggagtggcacccct
gggggacctgaactgctcctgggagccgcgtggggaccgagccaccccgttcctgctgca
cctgcagagccactaccaccccagcaggacgtacaccgtggcggtggctgccgggcagca
ctgggtgacggtgcctcgggaagagctcaccgcctcggacaaactccgtgtctgggggtc
cggggcgggccggccgctggggcctccgatctccgtgaacctggacacccgagtgaaacc
gaatgtgccacagctgtggccagacgtggacttctcagagggcgaacccctggacgccac
ggtgcactgggcagcacctacgtggccgtcccataaagtcctcatctgccagttccgcta
ccagaaatgcctggagcaggactgggtcctgctggaaccagaactggaaaccatcccact
gagtcccctggaaatccaggacctggagctggccaccagctaccgggtgtccgggcgctg
ccgcacgcaggacgaagaggacttgtggggcgagtggagccccagtctctccttccagac
gctgccctcgggtgggacctctgggcttgacccacacatcccctgtgcccaggagtctgt
ctctctcattcattccaccaccacgaccaccaccactttgtttctcttcttcctagctcc
aaaagacgtgtgggtgtctgggaacctctgcgggacgcctggcgcacaggaccccctgct
tctgtggacgcccccagggtcctgcctgccagtgagctacagagtgtggtttccagagca
ggagccgcctggggaaggggtcgcctgctgcagcgtgcgcatccccgcgggtgcccagtg
ggctgctgtgtccgccgtgaacgccacgagctggaagccgctcaccaacctctccttggc
ctgcttggactctgccccccgcggcgtggtggtcagcagtgcggggagcggggaactgcg
agtgagctggcgaccgccgggatccggggagccacaggagtacgtggtggactgggccag
agatggagagcccctggagaagctgacctgggcgcggcttcctcccaggaggctcagtgc
cctgttagcagggaacttcacagaaggggtcccctatcggatcacggtgaccgcagtctc
gcctgggggcgtggcccctgctccgccggtgtgggggttcacccaggagctagcacctgt
catagggccggcgctttggcgactccgggatgaccccccggggacccccgccgtagcttg
ggcggtggtccccaggcaccagctccgaggccatctcactcactacaccgtgtgtgcccg
gagtggaggccgacccttggtctgtgtgaacgtgaatggcagcatctggaacatcaccct
gcccgaccttccccggggtccctgcgagctgtgggtgactgcgtccaccacggcggggca
gggtccacctggtcccagcctgtggcttcacctgccagataacagcctggggtggaaagt
gctgcccggtgtcctgtccctttggggcttgttcttcgtgggctgtggcctggccctcac
cttgtcgggcaggtgcctccacctgcgatacaaagtgctgccccgctggctgtgggagaa
ggttccagaccctgccaacagtcagtccggccagccccccacagaggaggtgcctccggt
gcagccccctggggacttggccatcctggaagtggaggagatgcagccgccgccggcccc
tgagcccccccaagccgctgcggcccccctggactgtgggtatgagaggcacttcctgcc
cactcctgaggagctgggcctgctgagcgtcccccaccctggggccctagatgccccggg
ctgcagggacctgcagtga

DBGET integrated database retrieval system