Oryctolagus cuniculus (rabbit): 103347723 Help Entry 103347723         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     103347723  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103347723    04215 Apoptosis - multiple species     103347723    04115 p53 signaling pathway     103347723  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103347723   09162 Cancer: specific types    05210 Colorectal cancer     103347723    05222 Small cell lung cancer     103347723   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103347723    05161 Hepatitis B     103347723    05160 Hepatitis C     103347723    05164 Influenza A     103347723    05162 Measles     103347723    05168 Herpes simplex virus 1 infection     103347723    05163 Human cytomegalovirus infection     103347723    05167 Kaposi sarcoma-associated herpesvirus infection     103347723    05169 Epstein-Barr virus infection     103347723   09171 Infectious disease: bacterial    05132 Salmonella infection     103347723    05134 Legionellosis     103347723    05152 Tuberculosis     103347723   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103347723   09164 Neurodegenerative disease    05010 Alzheimer disease     103347723    05012 Parkinson disease     103347723    05014 Amyotrophic lateral sclerosis     103347723    05016 Huntington disease     103347723    05017 Spinocerebellar ataxia     103347723    05020 Prion disease     103347723    05022 Pathways of neurodegeneration - multiple diseases     103347723   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103347723    05416 Viral myocarditis     103347723   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103347723   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103347723 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Tll0287-like Cytochrome_CBB3 Motif Other DBs NCBI-GeneID:  103347723 NCBI-ProteinID:  XP_008252897 LinkDB All DBs Position 2:complement(92844931..92845239) Genome browser AA seq 102 aa AA seqDB search MSDAEKGEISAQKCVQCHTVRKGGKPRSGQNLHGLFGWKTGQAVGFSYTDGNRNKAITWE GDILIEYLENLKKYIPGTKFIFIGIKKRNERADLMAYLKEDY NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgctgagaaaggcgagatttctgctcagaaatgtgtccagtgccacactgtg agaaaggggggcaagcccaggtctgggcagaatctccatggcctgtttgggtggaagaca ggtcaggctgttggattctcttacacagatggcaacaggaacaaagccatcacctgggag ggggacattctgatagagtatttggagaatctcaagaaatacatccctggaaccaaattt attttcattggaattaagaaaaggaatgaaagggcagacttgatggcttatctcaaagag gactactaa

DBGET integrated database retrieval system