Oryctolagus cuniculus (rabbit): 103348469 Help Entry 103348469         CDS       T03373                                  Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103348469    04061 Viral protein interaction with cytokine and cytokine receptor     103348469  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103348469    04062 Chemokine signaling pathway     103348469  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     103348469 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    103348469 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103348469 NCBI-ProteinID:  XP_008255555 Ensembl:  ENSOCUG00000015478 UniProt:  G1T9I5 LinkDB All DBs Position 5:13542480..13546794 Genome browser AA seq 93 aa AA seqDB search MASMQAPLLAALMLLAVVLQATEAGPYGANVEDSVCCRDYMRRPLAPRVVKYFYWTSDSC RRPGVVLVTLKGLEICADPRLPWVKKILRKLEQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcatgcaggccccgctcctggctgctctcatgctcctggctgtggtacttcaa gcaacggaggcaggtccctatggcgcgaacgtcgaggacagcgtgtgctgccgcgactac atgcgccggcccctggccccgcgtgtggtcaagtatttctactggacttcggactcctgc cggaggcctggcgtggtcttggtgaccctcaaaggcctggagatctgtgccgaccccaga ctgccctgggtgaagaagattctccggaagctggaacagtga

DBGET integrated database retrieval system