KEGG   Oryctolagus cuniculus (rabbit): 103348469
Entry
103348469         CDS       T03373                                 
Symbol
CCL22
Name
(RefSeq) C-C motif chemokine ligand 22
  KO
K21095  C-C motif chemokine 22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103348469 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103348469 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103348469 (CCL22)
   04062 Chemokine signaling pathway
    103348469 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103348469 (CCL22)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103348469 (CCL22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103348469
NCBI-ProteinID: XP_008255555
Ensembl: ENSOCUG00000015478
UniProt: G1T9I5
LinkDB
Position
5:13517396..13521700
AA seq 93 aa
MASMQAPLLAALMLLAVVLQATEAGPYGANVEDSVCCRDYMRRPLAPRVVKYFYWTSDSC
RRPGVVLVTLKGLEICADPRLPWVKKILRKLEQ
NT seq 282 nt   +upstreamnt  +downstreamnt
atggccagcatgcaggccccgctcctggctgctctcatgctcctggctgtggtacttcaa
gcaacggaggcaggtccctatggcgcgaacgtcgaggacagcgtgtgctgccgcgactac
atgcgccggcccctggccccgcgtgtggtcaagtatttctactggacttcggactcctgc
cggaggcctggcgtggtcttggtgaccctcaaaggcctggagatctgtgccgaccccaga
ctgccctgggtgaagaagattctccggaagctggaacagtga

DBGET integrated database retrieval system