KEGG   Oryctolagus cuniculus (rabbit): 103348470
Entry
103348470         CDS       T03373                                 
Symbol
CCL17
Name
(RefSeq) C-C motif chemokine ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103348470 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103348470 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103348470 (CCL17)
   04657 IL-17 signaling pathway
    103348470 (CCL17)
   04062 Chemokine signaling pathway
    103348470 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103348470 (CCL17)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103348470 (CCL17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103348470
NCBI-ProteinID: XP_008255558
LinkDB
Position
5:13557866..13559607
AA seq 93 aa
MPGTMHPLRLLFLVVVLLGAALQHSHAARATNVGRECCQEFFKGAIPLRKLVSWLVTTQG
RLVCSDPKDGRVRKAIRRLPRLTVPRDLADRKS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcctggcaccatgcaccccctgaggctgctgttcctggttgttgtcctcctgggggcg
gccctgcagcacagccacgcagctcgagccaccaacgtgggccgggagtgctgccaggag
ttcttcaagggcgcgatccccctgcggaagctggtgtcgtggcttgtaaccacccagggc
aggctcgtctgctcggaccccaaggatgggcgagtgagaaaggccatcagacgcctgcca
agactcaccgtgccgcgggacctcgccgaccggaagtcctga

DBGET integrated database retrieval system