KEGG   Oryctolagus cuniculus (rabbit): 103348594
Entry
103348594         CDS       T03373                                 
Symbol
IL21R
Name
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103348594 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103348594 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103348594 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    103348594 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103348594 (IL21R)
   04090 CD molecules [BR:ocu04090]
    103348594 (IL21R)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   103348594 (IL21R)
CD molecules [BR:ocu04090]
 Proteins
  103348594 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 103348594
NCBI-ProteinID: XP_017198027
LinkDB
Position
6:17607092..17622757
AA seq 539 aa
MQRGWAALLLLLVLQGGWGCQDLTCYTDYLQTVTCVLETWTLHPWLLTLTWQDQYGELQD
EVTSCSLHRSGHNATHASYTCHMDVFRFMADDIFSVNVTDPTGNHSQECGSFMLADSIKP
APPFNVTVTFLGYYNVSWSTDYEDPTFYALRGKLQYEVQYRNRADPWARSPGRKLVSVDS
RSVSLLAQEFRRDSSYELQVRAGPQPGSSFQGTWSEWSDPVVFQTQTEEAKGGWDPHLLL
LLLVVMAPILVFLGLKIHLPWRLWKKVWVPVPSPEQFFQPLYQGHSGDFKKWVGTPFSPS
SLAEGPWAPRVSSVLEVQDHEDHSLHSPAKGPGPTELPEPAGLETDGPEPGPTMASSLGS
SADSQERDRPYGVVSIIDTVTVVGAEGPCTWLCTCGDDGYPALNLDVNLEAGLEPEDPPV
GSATEALPCHWVSAGGPGLGGSGSGLLDRVKLSFAGEEPWASSPPWQGGPPGGVPQSEAG
SPPAGLDMDTFDSGFAGSDCGSPVECDFASPVDEGPPRSYLRQWVAIAPAPAGPGPQAS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcaacgtggctgggctgccctcttgctcctgctggtgctccagggcggctggggctgc
caagacctcacctgctacactgattacctacagacggtcacctgtgtcctggagacctgg
accctgcacccctggctgctcacccttacctggcaggaccagtatggagagctccaggac
gaggtcacttcctgcagcctgcacaggtctggccacaacgccacacacgccagctacacc
tgccacatggatgtgttccgcttcatggccgatgacatcttcagcgtcaacgtgacggac
ccaactggcaatcactcgcaggagtgcggcagcttcatgctggctgatagcatcaagcct
gcaccccctttcaacgtgactgtgaccttcctgggatactacaacgtctcttggagcacc
gattatgaagaccccaccttctacgcgctgaggggcaagctgcagtacgaagtgcagtac
aggaatcgggccgacccctgggctcggagtccggggagaaagctggtctcagtggattcc
agaagcgtttccctcctggcccaggagttccgcagagactcgagctacgagctgcaggtg
cgggcggggccccagcctggctcctccttccagggcacatggagcgagtggagcgaccct
gtcgtctttcagacccagacagaagaggctaagggaggctgggaccctcacctgctgctt
ctcctcctggttgtcatggcccccatccttgtcttcttgggcctgaagatccatctgcct
tggaggctatggaagaaggtgtgggtgccagtgcccagcccggagcagttcttccagccc
ctgtaccaaggccacagtggagacttcaagaaatgggtgggcacacccttcagtccctcc
agcctggctgagggaccctgggccccaagggtgagctcggtcctggaggtgcaggaccac
gaagaccactccctgcacagtcctgccaagggcccgggacctacggagctgcctgagccg
gcagggctggagacagacgggcctgagccgggccccaccatggccagcagcctgggcagc
tcggctgacagccaggagagggaccggccatacggcgtggtgtccatcatagacacggtg
accgtggtgggcgcagaggggccctgcacttggctctgcacctgtggggacgacggctac
ccagccctgaacctggatgtcaacttggaggcaggcctggagcccgaggacccgccggtg
ggctcagcaactgaggccctcccttgccactgggtctcggccggtgggccggggctgggc
ggctctgggagtggcctcctcgacagggtcaagctgtcctttgccggggaggagccctgg
gcctccagccctccctggcaaggagggccgcctggaggcgtcccccagagtgaggcgggc
tcaccgcccgcaggcctagacatggacacattcgacagtggctttgcgggctcagactgc
ggcagccccgtggagtgcgactttgccagccccgtggacgaggggcctcccaggagctac
ctccgccagtgggtggccatagccccagcacctgcaggccctgggccccaggccagctaa

DBGET integrated database retrieval system