KEGG   Oryctolagus cuniculus (rabbit): 103348897
Entry
103348897         CDS       T03373                                 
Symbol
CCL20
Name
(RefSeq) C-C motif chemokine ligand 20
  KO
K14625  C-C motif chemokine 20
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103348897 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103348897 (CCL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103348897 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103348897 (CCL20)
   04062 Chemokine signaling pathway
    103348897 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    103348897 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103348897 (CCL20)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103348897 (CCL20)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103348897
NCBI-ProteinID: XP_008257494
Ensembl: ENSOCUG00000000868
LinkDB
Position
7:169685845..169689972
AA seq 97 aa
MTCGSKSLLLSALMSLLLLHLCSKLEAASNFDCCLRYTECRIHPRFIVGFTQQLANEACD
INAIILHTKKNLSVCADPKKEWVKRVVHILSNRVKKM
NT seq 294 nt   +upstreamnt  +downstreamnt
atgacgtgtggtagcaaatctttacttctgtctgcattgatgtcattgctgctactgcat
ctctgcagcaagttggaagcagcaagtaactttgactgctgccttcggtatacagaatgt
agaattcatcccagatttatcgtgggcttcacacagcagctggccaatgaagcgtgtgac
atcaatgctatcatccttcacacaaagaaaaatttgtctgtgtgtgcagatccgaagaag
gaatgggtgaaaagagttgtgcatatcctcagtaacagagtcaagaaaatgtaa

DBGET integrated database retrieval system