KEGG   Oryctolagus cuniculus (rabbit): 103349030
Entry
103349030         CDS       T03373                                 
Symbol
IL17D
Name
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103349030 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349030 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103349030 (IL17D)
   04657 IL-17 signaling pathway
    103349030 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349030 (IL17D)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   103349030 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 103349030
NCBI-ProteinID: XP_008258148
Ensembl: ENSOCUG00000003940
LinkDB
Position
8:complement(43865156..43885936)
AA seq 209 aa
MARPEGWMLVAGFLLALPPGRAAGAPRSGRLPARPRGCADRPEELLEQLYGRLAAGVLSA
FHHTLQLGPREQARNASCPAGGRPADRRFRTPTNLRSVSPWAYRISYDPARYPRYLPEAY
CLCRGCLTGLFGEEDFHFRSTPVYMPTVVLRRTPACAGGRAVYTEDYVTIPVGCTCVPEQ
EKDADSLNSSMDKQGAKLLLSPNDQPASS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcgcccggagggctggatgctcgtggccggcttcctgctggcgctgccgccgggc
cgggcggcgggcgcgccgaggagtggcaggctcccggcgcggccgcggggctgcgcggac
cggcccgaggagctcctggagcagctgtacgggcggctggcggccggggtgctcagcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgcaacgcgagctgcccagca
gggggcaggcccgccgaccgccgcttccggacgcccaccaacctgcgcagcgtgtcgccc
tgggcctacagaatctcctacgacccggccaggtaccctaggtacctgcccgaagcctac
tgcctgtgccgcggctgcctgacggggctcttcggggaggaggacttccacttccgcagc
accccggtgtacatgcccaccgtcgtgctgcgccgcaccccggcctgcgccggcggccgc
gccgtctacaccgaggactacgtcaccatccccgtgggctgcacctgcgtccccgagcag
gagaaggacgcggacagcctcaactccagcatggacaagcagggcgccaagctgctgctc
agccccaacgaccagccggccagctcctga

DBGET integrated database retrieval system