KEGG   Oryctolagus cuniculus (rabbit): 103349210
Entry
103349210         CDS       T03373                                 
Symbol
CXCR6
Name
(RefSeq) C-X-C motif chemokine receptor 6
  KO
K04191  C-X-C chemokine receptor type 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349210 (CXCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103349210 (CXCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    103349210 (CXCR6)
   04050 Cytokine receptors [BR:ocu04050]
    103349210 (CXCR6)
   04090 CD molecules [BR:ocu04090]
    103349210 (CXCR6)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    103349210 (CXCR6)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   103349210 (CXCR6)
CD molecules [BR:ocu04090]
 Proteins
  103349210 (CXCR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3290
Other DBs
NCBI-GeneID: 103349210
NCBI-ProteinID: XP_008258735
Ensembl: ENSOCUG00000004317
LinkDB
Position
9:14291383..14296012
AA seq 395 aa
MRVAWVCRATSRGLLNTRRKPGPHHRSGGGSGLVSKLISGTTAKAPLLVFVGGATTMEDE
YSDPGFFNSTDSSQEQECFLRFRKVFVPCVYLAVFTCGLIGNSLVLVIYIFYQKLKSLTD
VFLMNLPLADLVFVCTLPFWAYAGLHEWVFGELMCRTLLGIYAINFYTSMLTLTCITVDR
FLAVVQATKAYNQQAARRSWGKAICVFIWVASFLVSLPQMIYGSVLDLDKHVCDYRNEKI
STMVLATQMALGFFLPLFAMIVCYSVIIRTLLRARGFRKHKSLKIIFLVVAVFLLTQMPF
NLVKLIRSTSWEYHAMTHFSYVVVVTEAVAYLRACLNPVLYAFVGLKFRKNFLKLVKDAG
CLPYLGVASQMKSSEDNSKTCSASHHAEATSMFQL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcgggtggcgtgggtctgcagagcaaccagccgagggctcttaaacactcggcggaaa
cctggcccacatcacaggagtggaggtggcagtggcctcgtgagcaagctcatctctgga
accacggccaaggcgcctctgctggtgtttgtcggaggagccaccacgatggaggacgag
tactccgaccctggcttcttcaactccacagacagcagccaggagcaagagtgcttctta
cgcttcaggaaggtcttcgtgccctgcgtgtacctggcggtgttcacctgcggcctgata
ggcaactccctggtgctggtcatctacatcttctaccagaagctgaagagcctgacagac
gtgttcctgatgaacctgcccctggccgacctggtcttcgtctgcactctgcccttctgg
gcctacgcaggcctccacgagtgggtctttggcgagctcatgtgcaggaccctgctgggc
atctacgccataaacttctacacgtccatgctcaccctcacctgcatcaccgtggatcgc
ttccttgcagtggttcaggccaccaaggcctacaaccagcaggccgcgcggaggagctgg
ggcaaagccatctgcgtgttcatctgggtggcctccttcctggtttctctgccgcagatg
atctacggcagtgtcctagacctcgacaagcacgtctgtgactaccgcaacgagaagatt
tccaccatggttcttgccacccagatggctctgggcttcttcctgccactgttcgccatg
attgtctgctactcggtcattatcaggaccctgcttcgggctcgcggcttccggaagcac
aagtctctcaagatcatcttcctggtagtggccgtgttcctgctgacccagatgccgttc
aacctggtgaagctcatccggagcacgagctgggagtaccacgccatgacccacttcagt
tacgtcgtcgtggtgacggaggccgtcgcgtacctgagggcctgcctgaaccctgtgctc
tacgcctttgtcggcctcaagttccgcaagaacttcctgaagcttgtgaaggacgctggc
tgcctcccttacctgggggttgcaagtcaaatgaagtcttctgaggacaattccaagacg
tgctctgcgtcccaccacgcggaggccaccagcatgttccagctgtag

DBGET integrated database retrieval system