KEGG   Oryctolagus cuniculus (rabbit): 103349580
Entry
103349580         CDS       T03373                                 
Symbol
TSLP
Name
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103349580 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349580 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349580 (TSLP)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   103349580 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 103349580
NCBI-ProteinID: XP_017200128
LinkDB
Position
11:30780100..30782925
AA seq 119 aa
MILPVDLRFFTVFCRISFPSFQTKSTEFNPTISCHNPSECLSTIERDTFTPTPGCASLPT
ADFARKTWAVFALRCPGYSRVQINSLQEVKKGEDTTNNCLEKASHLLGLWRRFSRISEE
NT seq 360 nt   +upstreamnt  +downstreamnt
atgattttgcctgtggacttaagattctttaccgttttttgccgaatttcttttccttcc
ttccagaccaaaagtaccgagttcaaccccaccatctcctgtcacaatccgtcggagtgc
ctcagtaccatcgaacgcgacaccttcactcccaccccaggctgtgcgtccctccccacc
gcagacttcgcccggaaaacctgggccgtctttgctctccggtgccccggctactccaga
gttcagataaatagtttgcaggaagtgaagaaaggagaagacacaaccaataactgcctg
gaaaaagcctcacacttactaggattgtggcgtcgttttagtcgaatttcagaagaataa

DBGET integrated database retrieval system