Oryctolagus cuniculus (rabbit): 103349694 Help Entry 103349694         CDS       T03373                                  Name (RefSeq) histone H2B type 1-B   KO K11252   histone H2B Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103349694  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103349694   09163 Immune disease    05322 Systemic lupus erythematosus     103349694   09165 Substance dependence    05034 Alcoholism     103349694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     103349694   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     103349694 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103349694 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103349694 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  103349694 NCBI-ProteinID:  XP_008260681 Ensembl:  ENSOCUG00000027227 UniProt:  G1SSZ8 LinkDB All DBs Position 12:complement(144715800..144716281) Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccctccaaatccgctcccgcccccaaaaagggctccaagaaggcgataaca aaggcgcagaagaaggatggcaagaagcgcaagcgcagtcgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcgcgc ctggcgcactacaacaagcgctcgaccatcacgtcgcgcgagatccagacggccgtgcgc ctgctgctgcctggtgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system