KEGG   Oryctolagus cuniculus (rabbit): 103350089
Entry
103350089         CDS       T03373                                 
Symbol
NGF
Name
(RefSeq) nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04722  Neurotrophin signaling pathway
ocu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103350089 (NGF)
   04014 Ras signaling pathway
    103350089 (NGF)
   04015 Rap1 signaling pathway
    103350089 (NGF)
   04020 Calcium signaling pathway
    103350089 (NGF)
   04151 PI3K-Akt signaling pathway
    103350089 (NGF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103350089 (NGF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103350089 (NGF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103350089 (NGF)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103350089 (NGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    103350089 (NGF)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350089 (NGF)
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   103350089 (NGF)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   103350089 (NGF)
SSDB
Motif
Pfam: NGF Spaetzle NTF3_N
Other DBs
NCBI-GeneID: 103350089
NCBI-ProteinID: XP_017201441
LinkDB
Position
13:48887880..48904891
AA seq 296 aa
MASSRGHSNEVLACDRAVQGAGWHAGPKLSSASGPNNGFSKGAAFCPGHAEVHSVMSMLF
YTLITALLIGIQAEPHADSNVPAGHALPQAHWTKLQHSLDTALRRARAAPAVAIAARVAG
QTRNITVDPRLFKKRRLRSPRVLFSTQPPLAAVDFEELDLEVDVGSPSNRTYRSKRSAPH
PVFHMGEFSVCDSVSVWVGDKTTATDIKGNEVKVLGEVNINNSVFKQYFFETKCRDPNPV
ESGCRGIDAKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKASRRG
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcctcgtctcgtggacactctaacgaagttctggcctgtgatcgtgcagtccagggg
gctggatggcatgctggacccaagctcagctcagcgtccgggcccaataacggcttttcc
aagggagcagctttctgtcctggccacgctgaggtgcatagcgtaatgtccatgttgttc
tacactctgatcacagcgttactgattggcatacaggcggaaccacatgcagacagcaat
gtcccagcaggacacgccctgccccaagcccactggactaaactgcagcattccctggac
acagccctccgcagagcccgcgcagcccctgccgtggccatagctgcacgggtggccggg
cagacccgcaacatcaccgtggaccccagactttttaagaaacgacgcctgcggtccccc
cgggtgctgttcagcacgcagcccccgctggccgctgtggactttgaggagctggacctg
gaggtggacgtgggctccccctccaacaggacttacaggagcaagcgctcggccccccac
cccgtcttccacatgggagagttctcggtgtgcgacagcgtcagcgtgtgggttggggac
aagaccaccgccacggacatcaagggcaatgaggtgaaggtactgggggaggtgaacatt
aacaacagcgtgttcaaacagtactttttcgagaccaagtgccgagaccccaatcccgtg
gagagcgggtgccgcggcattgacgcaaagcactggaactcgtactgcaccacgactcac
acgttcgtcaaggcgctgaccacggacgacaagcaggccgcctggcgcttcatccgcatc
gacacagcctgcgtgtgcgtgctcagcaggaaggcttcccggaggggctga

DBGET integrated database retrieval system