KEGG   Oryctolagus cuniculus (rabbit): 103350772
Entry
103350772         CDS       T03373                                 
Symbol
CXCL9
Name
(RefSeq) C-X-C motif chemokine ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103350772 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103350772 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103350772 (CXCL9)
   04062 Chemokine signaling pathway
    103350772 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350772 (CXCL9)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103350772 (CXCL9)
SSDB
Motif
Pfam: IL8 DUF6675 Rtf2
Other DBs
NCBI-GeneID: 103350772
NCBI-ProteinID: XP_008265949
Ensembl: ENSOCUG00000029588
UniProt: U3KNX2
LinkDB
Position
15:74394560..74401450
AA seq 153 aa
MVPKSMFCKEFLRLPIQYKSDLTGLHSTTMKKSCVLFLLGFTFLVLIGVQGSPIMRNGRC
SCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKK
QSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
NT seq 462 nt   +upstreamnt  +downstreamnt
atggttcccaagagcatgttttgtaaagaatttctcaggcttccaatccagtacaagagt
gacttaacaggactccattccaccactatgaagaaaagttgtgttctgttcctcttgggt
ttcaccttcttggttctgattggagttcaaggaagtccaataatgaggaatggacgctgt
tcttgcatcagcagcacccaagggaagatccacctacaatccttaaaagaccttaaacag
ttttccccaagcccttcctgtgggaagactgaaatcattgccacaaagaaggatgggact
caaatatgtctaaatccggattcaaccgaggtgaaagaattggtagaaaagtggaaaaaa
cagagtagcccaaagaaaaagcaaaagaaagggaaaaaacagcgcaaagtcaagaaatct
ctcaaaaagtctcaacgtcctcatcaaaagaagactgcataa

DBGET integrated database retrieval system