KEGG   Oryctolagus cuniculus (rabbit): 103350825
Entry
103350825         CDS       T03373                                 
Symbol
PPBP
Name
(RefSeq) pro-platelet basic protein
  KO
K10029  platelet basic protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103350825 (PPBP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103350825 (PPBP)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103350825 (PPBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350825 (PPBP)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103350825 (PPBP)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103350825
NCBI-ProteinID: XP_008266105
LinkDB
Position
15:complement(76286735..76287577)
AA seq 100 aa
MSPKLNTTSFGTSARRFCVLQVLLLLSLLLTMLVPSTSGQMVDSEMYAELRCTCLKTMSR
IHPSSISKLEVIREGVHCSKMELIATMTMERNLLNTEAPD
NT seq 300 nt   +upstreamnt  +downstreamnt
atgagccccaagctgaacaccacctccttcggcaccagtgcccgccggttttgtgtccta
caggtgttgctgctgttgtcactgctcctgaccatgctggttccctccaccagtggacaa
atggtagattcagagatgtatgctgaactgcgctgcacatgtttgaagacaatgtctcga
attcatcccagtagcatcagcaaattggaggtcatcagggaaggagtccattgctccaaa
atggagttgatagccacaatgacgatggaaagaaatctgctgaacacagaagctccagat

DBGET integrated database retrieval system