KEGG   Oryctolagus cuniculus (rabbit): 103351522
Entry
103351522         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 23
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351522
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351522
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351522
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351522
SSDB
Motif
Pfam: IL8 MC3 ESF1
Other DBs
NCBI-GeneID: 103351522
NCBI-ProteinID: XP_008269360
Ensembl: ENSOCUG00000000686
LinkDB
Position
19:complement(24980990..24987111)
AA seq 125 aa
MKVSVAALSFLALILAAALGSQALVTHDTDTKQLALVVDRFDKEIVQGFHRPTDCCFSYT
KRNIQCFLMQDYIETSSQCSMPAVIFLTKRGQKVCADSSDERVRKCVSSLQRDLPTRNLG
IVALA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctccttcctcgccctcatccttgcagctgccctgggc
tcgcaggccctggtcacacatgatacagacacaaaacagctcgccttggtggtggataga
tttgataaagaaatcgtccaaggcttccaccgccctacagactgctgcttctcctacaca
aaacgaaacatccagtgcttcctcatgcaagattatattgagaccagcagtcagtgctcc
atgccagctgtcatcttcctcaccaagaggggacaaaaagtgtgtgctgactccagtgat
gagagagtccggaagtgtgtgtcaagcctgcaaagggacctgccgaccaggaatctagga
atagtggcactggcttga

KEGG   Oryctolagus cuniculus (rabbit): 103351523
Entry
103351523         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 15
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351523
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351523
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351523
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351523
SSDB
Motif
Pfam: IL8 Chlam_OMP3
Other DBs
NCBI-GeneID: 103351523
NCBI-ProteinID: XP_008269362
Ensembl: ENSOCUG00000029281
LinkDB
Position
19:complement(24971837..24977356)
AA seq 138 aa
MKLSTAALSLLLLAAVLGTQAFVLHNTETRQLTRAMDRLINRRPIQGVNPIQSIMPLSSN
VRPSDCCYGYTTRPLQCSVMEDFFETNSQCSMPAVIFITKCGKLICANPRNNEVEECMET
LKTQGTRLGPRAAAGLLY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaagctctccacggctgccctctccctcctcctccttgctgctgtccttggcacccag
gccttcgtcttgcacaatacagagacgagacagctcaccagggcgatggacaggcttatt
aatagaagacccatccaaggtgtaaaccctatacaatcaatcatgcctctatcttcaaat
gtgcgtcctagtgactgctgctatggctacaccacacgacccctccagtgttcagttatg
gaagatttctttgagaccaacagtcagtgctccatgccagctgtcatcttcatcactaaa
tgtggaaaactgatctgtgccaaccccagaaataatgaagttgaagaatgcatggaaacc
ctgaagacccagggaaccagattaggccccagggcagcagcagggttgctttactaa

DBGET integrated database retrieval system