KEGG   Oryctolagus cuniculus (rabbit): 103351619
Entry
103351619         CDS       T03373                                 
Symbol
CCL16
Name
(RefSeq) C-C motif chemokine 16
  KO
K21093  C-C motif chemokine 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351619 (CCL16)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351619 (CCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351619 (CCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351619 (CCL16)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351619 (CCL16)
SSDB
Other DBs
NCBI-GeneID: 103351619
NCBI-ProteinID: XP_008270002
LinkDB
Position
19:complement(24957002..24957617)
AA seq 121 aa
MEVGSHGLPPCSPSSNVMIAKIPDGVDYPPHXCLKFHEKALPGKLVPGSRRALSCHLPVS
YGVAADVCQHKNLEVCTNSEDTRAQEHLQDPWPPLLPARTPALVKTIGSERGQPQPQPLF
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggtaggcagccatggtctgcctccctgctccccatcatccaatgtgatgattgca
aaaattcctgacggggtagactatccaccccactgatgcctgaagttccatgagaaagca
ttgccggggaaactggtgccaggatccagaagggccctcagctgccacttgccagtgagc
tatggagtagcggctgacgtttgtcaacataaaaacctggaggtctgcaccaactctgaa
gacacccgggcccaagagcacctccaggatccctggccacctctgctgcctgccagaacc
ccagccctggttaaaaccatcggatcagagaggggacagccccagccccagcccctcttc
cattag

DBGET integrated database retrieval system