KEGG   Oryctolagus cuniculus (rabbit): 103351784
Entry
103351784         CDS       T03373                                 
Symbol
IL11RA
Name
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103351784 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351784 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103351784 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103351784 (IL11RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   103351784 (IL11RA)
SSDB
Motif
Pfam: Ig_3 Ig_2 EpoR_lig-bind ig
Other DBs
NCBI-GeneID: 103351784
NCBI-ProteinID: XP_008270731
Ensembl: ENSOCUG00000023782
LinkDB
Position
1:complement(19163370..19168066)
AA seq 422 aa
MSSSCSGLSRVLVAVATALVSASSPCPQAWGPQGVQYGQPGKSVLLCCPGVTAGALVSWF
RDGEPRLLQGPDSGLGHALVLTHVGHTDEGNYICRTLDGALWGMVTLQLGYPPARPVVSC
QATDYENFSCTWSSSQVSGLPTRYLTSYRKKTIPGADGQRMSPSTGPWPCPQDPVGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQNILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHLAWSTVEPVGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSAGPLTKEIAPGTQVHTQPEVDPRVDSPAPPRSSLQPDPRPLDHR
DPLEYVAVLVSLGILSFLGLAAGALAVGLWLRLRWSGKDGPPKPGFLAPMIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggctgtggctacagccctggtg
tctgcctcttccccctgcccccaggcctggggcccccaaggggtccagtatgggcagcct
ggcaagtctgtgctgctgtgttgccccggagtgactgctggggccctggtgtcctggttt
cgggacggggagccaaggctgctccagggacctgattctgggttgggacatgcattggtc
ctgacccacgtaggccacactgacgagggcaactacatctgccggaccctggatggggca
ctttggggcatggtgaccctgcagctgggctatcccccagcccgccctgttgtctcctgc
caagcaactgactatgagaacttctcctgcacttggagttccagccaggtcagcggttta
cccacccgctacctcacctcctacaggaagaagaccattccaggagctgatggtcagagg
atgagtccatccacagggccctggccatgcccacaggaccccgtaggggctgcccgttgt
gtggtccatggggcagagttctggagccagtaccggattaatgtgaccgaggtgaaccca
ctgggtgccagcacgcggctgctggacgtgagcctgcagaacatcttgcgccctgaccca
ccccaggggctgcgggtggagtctgtacccggttaccccagacgcctgcgtgccagctgg
acataccctgcctcctggccccgccagccccacttcttgctcaagttccggctgcagtac
cgcccagcgcagcatctagcctggtccacggtggagccggtgggattggaggaggtgatc
accgacgctgtggctgggctgccccatgccgtgcgcgtcagtgcccgggactttctggac
gctggcacctggagtgcctggagcccggaagcctggggaactccaagtgctgggcccctg
acgaaggagatagcacctgggacccaggtacacacgcaaccagaggtggatcctcgggtc
gacagcccggctcctccacggtcctccctccagccagacccgcggccacttgatcacagg
gaccccctggagtatgtggctgtgctggtgtctttgggaatcctctctttcctgggactg
gcagcgggggctctggcagtagggctgtggctgaggctgagatggagtgggaaggatgga
cccccaaagcctgggttcttggccccgatgattccagtggacaagcttccaggagctcca
aacctatag

DBGET integrated database retrieval system