Oryctolagus cuniculus (rabbit): 103351930 Help Entry 103351930         CDS       T03373                                  Name (RefSeq) histone H2B type F-M-like   KO K11252   histone H2B Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103351930  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103351930   09163 Immune disease    05322 Systemic lupus erythematosus     103351930   09165 Substance dependence    05034 Alcoholism     103351930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     103351930   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     103351930 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103351930 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103351930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF29 Motif Other DBs NCBI-GeneID:  103351930 NCBI-ProteinID:  XP_008271233 LinkDB All DBs Position X:52522243..52522647 Genome browser AA seq 134 aa AA seqDB search MAEPSPQRTCEESVVSQEPKKAPSPSWRRVAPRRACRRLPTWDLSLAPYFSRILRRQNEN LSLSREAKSLLDTLLKELLEHILNEAAQLVREKQGVALSVLEIQSAVRRLLPRELGLSVD MQAINALLEHSSHS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggctgagccctcgcctcagcggacctgtgaggagagcgtggtcagccaggagcccaag aaggcgccgtcgccctcctggaggcgggtggccccccggcgggcctgccgccgcctcccg acttgggatctcagcttggccccctatttctccaggatcctgaggaggcagaatgagaac ctcagcctgtcccgcgaggccaagagcctcctggacacgctcctgaaggagctcttggag cacatcctcaacgaggctgcccagctggtccgcgaaaagcagggagtggccctcagcgtt ctggagatccagagcgcggtgcgccgcctgctgccccgcgagctgggcctgtccgtggac atgcaggccatcaacgccctcctggagcacagcagccacagctga

DBGET integrated database retrieval system