KEGG   Oryctolagus cuniculus (rabbit): 107546750
Entry
107546750         CDS       T03373                                 
Symbol
CCL11
Name
(RefSeq) chemokine (C-C motif) ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
ocu05310  Asthma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107546750 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107546750 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107546750 (CCL11)
   04062 Chemokine signaling pathway
    107546750 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107546750 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    107546750 (CCL11)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   107546750 (CCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107546750
NCBI-ProteinID: NP_001309361
Ensembl: ENSOCUG00000005935
UniProt: G1SPZ3
LinkDB
Position
19:23739202..23742061
AA seq 96 aa
MKVSAALLCMLVTAAVFSSQVLAQPAFVPTTCCFSMAKKMPLQRLESYRRISGSKCPQKA
VIFKTKLAKEICADPKEKWVQDSIKYLDQKSKTSKP
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcagcacttctctgcatgctggtcacggcggctgttttcagctcccag
gtgcttgctcagccagcttttgtcccaaccacttgctgcttctctatggccaagaagatg
cccctccagcggctggagagctacagaagaatcagtggcagcaaatgcccccagaaagct
gtgatcttcaagaccaagttggccaaggagatctgtgctgaccccaaggagaagtgggtc
caagattctataaaatacctggaccaaaaatccaaaacttcaaagccatag

DBGET integrated database retrieval system