Oryctolagus cuniculus (rabbit): 127486605 Help Entry 127486605         CDS       T03373                                  Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04062   Chemokine signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04211   Longevity regulating pathway ocu04213   Longevity regulating pathway - multiple species ocu04218   Cellular senescence ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04510   Focal adhesion ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04625   C-type lectin receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04714   Thermogenesis ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04929   GnRH secretion ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu05010   Alzheimer disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05132   Salmonella infection ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127486605    04012 ErbB signaling pathway     127486605    04014 Ras signaling pathway     127486605    04015 Rap1 signaling pathway     127486605    04370 VEGF signaling pathway     127486605    04371 Apelin signaling pathway     127486605    04630 JAK-STAT signaling pathway     127486605    04068 FoxO signaling pathway     127486605    04072 Phospholipase D signaling pathway     127486605    04071 Sphingolipid signaling pathway     127486605    04151 PI3K-Akt signaling pathway     127486605    04150 mTOR signaling pathway     127486605  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127486605    04140 Autophagy - animal     127486605    04137 Mitophagy - animal     127486605   09143 Cell growth and death    04210 Apoptosis     127486605    04218 Cellular senescence     127486605   09144 Cellular community - eukaryotes    04510 Focal adhesion     127486605    04540 Gap junction     127486605    04550 Signaling pathways regulating pluripotency of stem cells     127486605   09142 Cell motility    04810 Regulation of actin cytoskeleton     127486605  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127486605    04650 Natural killer cell mediated cytotoxicity     127486605    04660 T cell receptor signaling pathway     127486605    04662 B cell receptor signaling pathway     127486605    04664 Fc epsilon RI signaling pathway     127486605    04062 Chemokine signaling pathway     127486605   09152 Endocrine system    04910 Insulin signaling pathway     127486605    04929 GnRH secretion     127486605    04912 GnRH signaling pathway     127486605    04915 Estrogen signaling pathway     127486605    04917 Prolactin signaling pathway     127486605    04921 Oxytocin signaling pathway     127486605    04926 Relaxin signaling pathway     127486605    04935 Growth hormone synthesis, secretion and action     127486605    04919 Thyroid hormone signaling pathway     127486605    04916 Melanogenesis     127486605   09156 Nervous system    04725 Cholinergic synapse     127486605    04726 Serotonergic synapse     127486605    04720 Long-term potentiation     127486605    04730 Long-term depression     127486605    04722 Neurotrophin signaling pathway     127486605   09158 Development and regeneration    04360 Axon guidance     127486605   09149 Aging    04211 Longevity regulating pathway     127486605    04213 Longevity regulating pathway - multiple species     127486605   09159 Environmental adaptation    04714 Thermogenesis     127486605  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127486605    05206 MicroRNAs in cancer     127486605    05205 Proteoglycans in cancer     127486605    05207 Chemical carcinogenesis - receptor activation     127486605    05208 Chemical carcinogenesis - reactive oxygen species     127486605    05203 Viral carcinogenesis     127486605    05230 Central carbon metabolism in cancer     127486605    05231 Choline metabolism in cancer     127486605    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     127486605   09162 Cancer: specific types    05210 Colorectal cancer     127486605    05225 Hepatocellular carcinoma     127486605    05226 Gastric cancer     127486605    05214 Glioma     127486605    05216 Thyroid cancer     127486605    05221 Acute myeloid leukemia     127486605    05220 Chronic myeloid leukemia     127486605    05218 Melanoma     127486605    05211 Renal cell carcinoma     127486605    05219 Bladder cancer     127486605    05215 Prostate cancer     127486605    05213 Endometrial cancer     127486605    05224 Breast cancer     127486605    05223 Non-small cell lung cancer     127486605   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127486605    05170 Human immunodeficiency virus 1 infection     127486605    05161 Hepatitis B     127486605    05160 Hepatitis C     127486605    05163 Human cytomegalovirus infection     127486605    05167 Kaposi sarcoma-associated herpesvirus infection     127486605    05165 Human papillomavirus infection     127486605   09171 Infectious disease: bacterial    05132 Salmonella infection     127486605   09164 Neurodegenerative disease    05010 Alzheimer disease     127486605    05022 Pathways of neurodegeneration - multiple diseases     127486605   09165 Substance dependence    05034 Alcoholism     127486605   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127486605   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     127486605   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     127486605    01522 Endocrine resistance     127486605  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     127486605   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     127486605    04031 GTP-binding proteins [BR:ocu04031]     127486605 Membrane trafficking [BR:ocu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127486605  Endocytosis   Macropinocytosis    Ras GTPases     127486605 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127486605   Exosomal proteins of colorectal cancer cells    127486605 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127486605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  127486605 NCBI-ProteinID:  XP_051686619 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGVPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGRG CLSCKCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggcgccggcggtgtaggcaagagcgcactgacc atccagctgatccagaaccacttcgtggacgaatatgaccccaccatcgaggactcgtac cggaagcaggtggtcatcgacggggagacgtgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcacgggcgagggcttcctctgc gtgttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggagcagatc aagcgggtgaaagactcggacgacgtgcccatggtgctggtggggaacaagtgcgacctg gcggcgcgcaccgtggagtcccggcaggcgcaggacctggcccgcagctacggcgtcccc tatatcgagacctccgccaagacgcggcagggcgtggaggacgcgttctacacgctggtg cgggagatccggcagcataagctgcggaagctgaacccgcccgacgagagcggccgcggc tgtctgagctgcaagtgtgtgctgtcctga

DBGET integrated database retrieval system