Oryctolagus cuniculus (rabbit): 808222 Help Entry 808222            CDS       T03373                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu04714   Thermogenesis ocu04723   Retrograde endocannabinoid signaling ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05415   Diabetic cardiomyopathy Module ocu_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     808222 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     808222 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     808222 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     808222 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     808222 (ND4L)    05012 Parkinson disease     808222 (ND4L)    05014 Amyotrophic lateral sclerosis     808222 (ND4L)    05016 Huntington disease     808222 (ND4L)    05020 Prion disease     808222 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     808222 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     808222 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ocu03029]     808222 (ND4L) Enzymes [BR:ocu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      808222 (ND4L) Mitochondrial biogenesis [BR:ocu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     808222 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  808222 NCBI-ProteinID:  NP_007557 UniProt:  O79435 A0A3Q8UF63 LinkDB All DBs Position MT:9906..10202 Genome browser AA seq 98 aa AA seqDB search MPSIYINIFLAFILALLGMLVYRSHLMSSLLCLEGMMLSLFVLITLTALNTHFTLSFMFP IILLVFAACEAAVGLALLVMVSNTYGMDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccttcaatctatattaatatcttcctagcatttatcctagctcttctaggcatacta gtctatcgatcccatctaatatcatcccttctatgcctagaaggcataatactctcacta tttgttctaattacattaacagcccttaatacccacttcacactatcatttatatttcca atcatcctactagtattcgcagcctgtgaagcagcagttggactagctcttctagttata gtctccaacacttatggaatagactatgtacaaaacctaaatcttctacaatgctaa

DBGET integrated database retrieval system