Oceanirhabdus sp. W0125-5: OW730_06855 Help Entry OW730_06855       CDS       T08747                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ocw  Oceanirhabdus sp. W0125-5 Pathway ocw00030   Pentose phosphate pathway ocw00051   Fructose and mannose metabolism ocw00710   Carbon fixation by Calvin cycle ocw01100   Metabolic pathways ocw01110   Biosynthesis of secondary metabolites ocw01120   Microbial metabolism in diverse environments ocw01200   Carbon metabolism ocw01230   Biosynthesis of amino acids Module ocw_M00007   Pentose phosphate pathway, non-oxidative phase, fructose-6P => ribose-5P Brite KEGG Orthology (KO) [BR:ocw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     OW730_06855 (rpiB)    00051 Fructose and mannose metabolism     OW730_06855 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     OW730_06855 (rpiB) Enzymes [BR:ocw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      OW730_06855 (rpiB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LacAB_rpiB LisH_PAC1 Motif Other DBs NCBI-ProteinID:  WBW98482 LinkDB All DBs Position 1424288..1424737 Genome browser AA seq 149 aa AA seqDB search MRIALGSDHGGINLKRSIIDYLVSEGHEIKDFGTDSSDSCDYPDYALPVAESVAAKEFDL GILICGTGIGISIAANKVPGVRAALCHNTFSAHATREHNNANILAMGERVVGTGLALDIV KTFINTEFEGGRHQRRIDKISEIEKKYMK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgagaatagctcttggaagtgatcatgggggaatcaatttaaaaagaagtataattgat tatcttgtatcagaaggacatgaaataaaggattttggaacggatagttcagattcttgc gactatccagattatgctcttcctgtagcggaaagtgttgcagcaaaagagtttgacctt ggaatacttatctgtggtacaggaattggtattagtattgctgcaaataaagtgccagga gttagagctgcactatgtcataatactttcagtgcacatgcaacaagagaacataataat gcgaatatattggcaatgggtgaaagagttgttggaacaggtcttgcacttgatatagtt aagacttttatcaatactgagtttgaaggtggtagacatcagagaagaattgataaaata tcagaaattgaaaagaaatatatgaaataa

DBGET integrated database retrieval system