Tepiditoga spiralis: OSSY52_01610 Help Entry OSSY52_01610      CDS       T06810                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ocy  Tepiditoga spiralis Pathway ocy00020   Citrate cycle (TCA cycle) ocy00720   Other carbon fixation pathways ocy01100   Metabolic pathways ocy01110   Biosynthesis of secondary metabolites ocy01120   Microbial metabolism in diverse environments ocy01200   Carbon metabolism ocy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ocy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OSSY52_01610   09102 Energy metabolism    00720 Other carbon fixation pathways     OSSY52_01610 Enzymes [BR:ocy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OSSY52_01610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_3 Fer4_17 Fer4_13 Fer4_15 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  BBE30020 UniProt:  A0A7G1G1G9 LinkDB All DBs Position 172854..173069 Genome browser AA seq 71 aa AA seqDB search MPSVKKNFKVEINYEYCKKCGLCYWICPTKTIIAGEYGKPEVPDHAKCIGCLQCEKICPD FAINVIEDGEK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccatccgtgaaaaaaaatttcaaggtggaaataaactatgagtactgtaaaaaatgt ggattatgttactggatatgtcctacaaaaacaataattgcaggagaatatggaaaacct gaagttccagatcatgctaaatgtattggatgtttacaatgtgaaaaaatatgtcctgat tttgcaataaatgttattgaggatggtgaaaaataa

DBGET integrated database retrieval system