KEGG   Ochotona curzoniae (black-lipped pika): 121151568
Entry
121151568         CDS       T11174                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ocz  Ochotona curzoniae (black-lipped pika)
Pathway
ocz01521  EGFR tyrosine kinase inhibitor resistance
ocz01522  Endocrine resistance
ocz01524  Platinum drug resistance
ocz04010  MAPK signaling pathway
ocz04012  ErbB signaling pathway
ocz04014  Ras signaling pathway
ocz04015  Rap1 signaling pathway
ocz04022  cGMP-PKG signaling pathway
ocz04024  cAMP signaling pathway
ocz04062  Chemokine signaling pathway
ocz04066  HIF-1 signaling pathway
ocz04068  FoxO signaling pathway
ocz04071  Sphingolipid signaling pathway
ocz04072  Phospholipase D signaling pathway
ocz04114  Oocyte meiosis
ocz04140  Autophagy - animal
ocz04148  Efferocytosis
ocz04150  mTOR signaling pathway
ocz04151  PI3K-Akt signaling pathway
ocz04210  Apoptosis
ocz04218  Cellular senescence
ocz04261  Adrenergic signaling in cardiomyocytes
ocz04270  Vascular smooth muscle contraction
ocz04350  TGF-beta signaling pathway
ocz04360  Axon guidance
ocz04370  VEGF signaling pathway
ocz04371  Apelin signaling pathway
ocz04380  Osteoclast differentiation
ocz04510  Focal adhesion
ocz04517  IgSF CAM signaling
ocz04520  Adherens junction
ocz04540  Gap junction
ocz04550  Signaling pathways regulating pluripotency of stem cells
ocz04611  Platelet activation
ocz04613  Neutrophil extracellular trap formation
ocz04620  Toll-like receptor signaling pathway
ocz04621  NOD-like receptor signaling pathway
ocz04625  C-type lectin receptor signaling pathway
ocz04650  Natural killer cell mediated cytotoxicity
ocz04657  IL-17 signaling pathway
ocz04658  Th1 and Th2 cell differentiation
ocz04659  Th17 cell differentiation
ocz04660  T cell receptor signaling pathway
ocz04662  B cell receptor signaling pathway
ocz04664  Fc epsilon RI signaling pathway
ocz04666  Fc gamma R-mediated phagocytosis
ocz04668  TNF signaling pathway
ocz04713  Circadian entrainment
ocz04720  Long-term potentiation
ocz04722  Neurotrophin signaling pathway
ocz04723  Retrograde endocannabinoid signaling
ocz04724  Glutamatergic synapse
ocz04725  Cholinergic synapse
ocz04726  Serotonergic synapse
ocz04730  Long-term depression
ocz04810  Regulation of actin cytoskeleton
ocz04910  Insulin signaling pathway
ocz04912  GnRH signaling pathway
ocz04914  Progesterone-mediated oocyte maturation
ocz04915  Estrogen signaling pathway
ocz04916  Melanogenesis
ocz04917  Prolactin signaling pathway
ocz04919  Thyroid hormone signaling pathway
ocz04921  Oxytocin signaling pathway
ocz04926  Relaxin signaling pathway
ocz04928  Parathyroid hormone synthesis, secretion and action
ocz04929  GnRH secretion
ocz04930  Type II diabetes mellitus
ocz04933  AGE-RAGE signaling pathway in diabetic complications
ocz04934  Cushing syndrome
ocz04935  Growth hormone synthesis, secretion and action
ocz04960  Aldosterone-regulated sodium reabsorption
ocz05010  Alzheimer disease
ocz05020  Prion disease
ocz05022  Pathways of neurodegeneration - multiple diseases
ocz05034  Alcoholism
ocz05132  Salmonella infection
ocz05133  Pertussis
ocz05135  Yersinia infection
ocz05140  Leishmaniasis
ocz05142  Chagas disease
ocz05145  Toxoplasmosis
ocz05152  Tuberculosis
ocz05160  Hepatitis C
ocz05161  Hepatitis B
ocz05163  Human cytomegalovirus infection
ocz05164  Influenza A
ocz05165  Human papillomavirus infection
ocz05166  Human T-cell leukemia virus 1 infection
ocz05167  Kaposi sarcoma-associated herpesvirus infection
ocz05170  Human immunodeficiency virus 1 infection
ocz05171  Coronavirus disease - COVID-19
ocz05200  Pathways in cancer
ocz05203  Viral carcinogenesis
ocz05205  Proteoglycans in cancer
ocz05206  MicroRNAs in cancer
ocz05207  Chemical carcinogenesis - receptor activation
ocz05208  Chemical carcinogenesis - reactive oxygen species
ocz05210  Colorectal cancer
ocz05211  Renal cell carcinoma
ocz05212  Pancreatic cancer
ocz05213  Endometrial cancer
ocz05214  Glioma
ocz05215  Prostate cancer
ocz05216  Thyroid cancer
ocz05218  Melanoma
ocz05219  Bladder cancer
ocz05220  Chronic myeloid leukemia
ocz05221  Acute myeloid leukemia
ocz05223  Non-small cell lung cancer
ocz05224  Breast cancer
ocz05225  Hepatocellular carcinoma
ocz05226  Gastric cancer
ocz05230  Central carbon metabolism in cancer
ocz05231  Choline metabolism in cancer
ocz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocz05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    121151568 (MAPK3)
   04012 ErbB signaling pathway
    121151568 (MAPK3)
   04014 Ras signaling pathway
    121151568 (MAPK3)
   04015 Rap1 signaling pathway
    121151568 (MAPK3)
   04350 TGF-beta signaling pathway
    121151568 (MAPK3)
   04370 VEGF signaling pathway
    121151568 (MAPK3)
   04371 Apelin signaling pathway
    121151568 (MAPK3)
   04668 TNF signaling pathway
    121151568 (MAPK3)
   04066 HIF-1 signaling pathway
    121151568 (MAPK3)
   04068 FoxO signaling pathway
    121151568 (MAPK3)
   04072 Phospholipase D signaling pathway
    121151568 (MAPK3)
   04071 Sphingolipid signaling pathway
    121151568 (MAPK3)
   04024 cAMP signaling pathway
    121151568 (MAPK3)
   04022 cGMP-PKG signaling pathway
    121151568 (MAPK3)
   04151 PI3K-Akt signaling pathway
    121151568 (MAPK3)
   04150 mTOR signaling pathway
    121151568 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    121151568 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    121151568 (MAPK3)
   04148 Efferocytosis
    121151568 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    121151568 (MAPK3)
   04210 Apoptosis
    121151568 (MAPK3)
   04218 Cellular senescence
    121151568 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    121151568 (MAPK3)
   04520 Adherens junction
    121151568 (MAPK3)
   04540 Gap junction
    121151568 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    121151568 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121151568 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    121151568 (MAPK3)
   04613 Neutrophil extracellular trap formation
    121151568 (MAPK3)
   04620 Toll-like receptor signaling pathway
    121151568 (MAPK3)
   04621 NOD-like receptor signaling pathway
    121151568 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    121151568 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    121151568 (MAPK3)
   04660 T cell receptor signaling pathway
    121151568 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    121151568 (MAPK3)
   04659 Th17 cell differentiation
    121151568 (MAPK3)
   04657 IL-17 signaling pathway
    121151568 (MAPK3)
   04662 B cell receptor signaling pathway
    121151568 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    121151568 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    121151568 (MAPK3)
   04062 Chemokine signaling pathway
    121151568 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    121151568 (MAPK3)
   04929 GnRH secretion
    121151568 (MAPK3)
   04912 GnRH signaling pathway
    121151568 (MAPK3)
   04915 Estrogen signaling pathway
    121151568 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    121151568 (MAPK3)
   04917 Prolactin signaling pathway
    121151568 (MAPK3)
   04921 Oxytocin signaling pathway
    121151568 (MAPK3)
   04926 Relaxin signaling pathway
    121151568 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    121151568 (MAPK3)
   04919 Thyroid hormone signaling pathway
    121151568 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    121151568 (MAPK3)
   04916 Melanogenesis
    121151568 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    121151568 (MAPK3)
   04270 Vascular smooth muscle contraction
    121151568 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    121151568 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    121151568 (MAPK3)
   04725 Cholinergic synapse
    121151568 (MAPK3)
   04726 Serotonergic synapse
    121151568 (MAPK3)
   04720 Long-term potentiation
    121151568 (MAPK3)
   04730 Long-term depression
    121151568 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    121151568 (MAPK3)
   04722 Neurotrophin signaling pathway
    121151568 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    121151568 (MAPK3)
   04380 Osteoclast differentiation
    121151568 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    121151568 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121151568 (MAPK3)
   05206 MicroRNAs in cancer
    121151568 (MAPK3)
   05205 Proteoglycans in cancer
    121151568 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    121151568 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    121151568 (MAPK3)
   05203 Viral carcinogenesis
    121151568 (MAPK3)
   05230 Central carbon metabolism in cancer
    121151568 (MAPK3)
   05231 Choline metabolism in cancer
    121151568 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    121151568 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    121151568 (MAPK3)
   05212 Pancreatic cancer
    121151568 (MAPK3)
   05225 Hepatocellular carcinoma
    121151568 (MAPK3)
   05226 Gastric cancer
    121151568 (MAPK3)
   05214 Glioma
    121151568 (MAPK3)
   05216 Thyroid cancer
    121151568 (MAPK3)
   05221 Acute myeloid leukemia
    121151568 (MAPK3)
   05220 Chronic myeloid leukemia
    121151568 (MAPK3)
   05218 Melanoma
    121151568 (MAPK3)
   05211 Renal cell carcinoma
    121151568 (MAPK3)
   05219 Bladder cancer
    121151568 (MAPK3)
   05215 Prostate cancer
    121151568 (MAPK3)
   05213 Endometrial cancer
    121151568 (MAPK3)
   05224 Breast cancer
    121151568 (MAPK3)
   05223 Non-small cell lung cancer
    121151568 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    121151568 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    121151568 (MAPK3)
   05161 Hepatitis B
    121151568 (MAPK3)
   05160 Hepatitis C
    121151568 (MAPK3)
   05171 Coronavirus disease - COVID-19
    121151568 (MAPK3)
   05164 Influenza A
    121151568 (MAPK3)
   05163 Human cytomegalovirus infection
    121151568 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    121151568 (MAPK3)
   05165 Human papillomavirus infection
    121151568 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    121151568 (MAPK3)
   05135 Yersinia infection
    121151568 (MAPK3)
   05133 Pertussis
    121151568 (MAPK3)
   05152 Tuberculosis
    121151568 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    121151568 (MAPK3)
   05140 Leishmaniasis
    121151568 (MAPK3)
   05142 Chagas disease
    121151568 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121151568 (MAPK3)
   05020 Prion disease
    121151568 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    121151568 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    121151568 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121151568 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    121151568 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    121151568 (MAPK3)
   04934 Cushing syndrome
    121151568 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    121151568 (MAPK3)
   01524 Platinum drug resistance
    121151568 (MAPK3)
   01522 Endocrine resistance
    121151568 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocz01001]
    121151568 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocz03036]
    121151568 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocz04147]
    121151568 (MAPK3)
Enzymes [BR:ocz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     121151568 (MAPK3)
Protein kinases [BR:ocz01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   121151568 (MAPK3)
Chromosome and associated proteins [BR:ocz03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     121151568 (MAPK3)
Exosome [BR:ocz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   121151568 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 121151568
NCBI-ProteinID: XP_040829019
LinkDB
Position
Unknown
AA seq 380 aa
MAAAAAAQGGGGGEPRGAEGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPAKTKVAWNKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPECP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgagggg
gtcggcccgggggtccccggggaagtggagatcgtcaaggggcagccgttcgacgtgggc
ccccgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcc
tatgaccacgtgcgtaagacccgcgtggccatcaagaagatcagccccttcgagcaccag
acctactgccagcgcacgctgcgcgagatccagattctactgcgcttccgccacgagaat
gtgatcggcatccgggacatcctccgcgcgcccaccctggacgccatgagggatgtctac
atcgtgcaggacctgatggagactgacctgtacaagttgctcaaaagccagcagctgagc
aatgaccacatctgctactttctctaccagatcctgcggggcctcaagtatatccactca
gccaatgtgctgcaccgggatctgaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgcgactttggtctggcccgcatcgcagaccctgagcatgaccacaccggc
tttctcacggagtacgtggccacacgctggtaccgggccccagagatcatgctgaactcc
aagggctataccaagtccatcgacatctggtctgtgggctgtatcctggctgagatgctc
tccaatcggcctatcttccccggcaagcactacctggaccaactcaaccacattctaggt
atcctgggctcgccgtcccaggaggacctcaactgtatcatcaacatgaaggcccgcaac
tacctgcagtcgctgcccgccaagaccaaagtggcctggaacaaactgtttcccaagtca
gactccaaggcccttgacctgctggaccgcatgttaaccttcaaccccaacaagcggatc
acggtggaggaagcactggctcacccctatctggagcagtactatgacccaacagacgag
cctgtggccgaggagcccttcaccttcgacatggagctggatgacctccccaaggagcgg
ctgaaggagctcatcttccaggagacggcccgcttccagcccggggccccggagtgcccc
tag

DBGET integrated database retrieval system