Oryx dammah (scimitar-horned oryx): 11452046 Help Entry 11452046          CDS       T07255                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda00190   Oxidative phosphorylation oda01100   Metabolic pathways oda04714   Thermogenesis oda04723   Retrograde endocannabinoid signaling oda05010   Alzheimer disease oda05012   Parkinson disease oda05014   Amyotrophic lateral sclerosis oda05016   Huntington disease oda05020   Prion disease oda05022   Pathways of neurodegeneration - multiple diseases oda05208   Chemical carcinogenesis - reactive oxygen species oda05415   Diabetic cardiomyopathy Module oda_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:oda00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     11452046 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     11452046 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     11452046 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     11452046 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     11452046 (ND4L)    05012 Parkinson disease     11452046 (ND4L)    05014 Amyotrophic lateral sclerosis     11452046 (ND4L)    05016 Huntington disease     11452046 (ND4L)    05020 Prion disease     11452046 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     11452046 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     11452046 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:oda03029]     11452046 (ND4L) Enzymes [BR:oda01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      11452046 (ND4L) Mitochondrial biogenesis [BR:oda03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     11452046 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 PAP2 Motif Other DBs NCBI-GeneID:  11452046 NCBI-ProteinID:  YP_004935418 UniProt:  G8J9I2 LinkDB All DBs AA seq 98 aa AA seqDB search MSLMHMNIMMAFAVSVTGLLMYRSQLMSSLLCLEGMMLPLFIMATLMILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYMQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccctcatacatataaacattataatagcgttcgcggtatctgtcacaggactacta atatatcgatcccagctaatatcatccctcctatgcctagaaggaatgatactaccacta ttcattatagccaccctaataatcctaaactcacacttcaccctggccagcatgatacct atcatcctactagtatttgcagcatgcgaagcagcactaggcctgtccctactagtaatg gtatcaaacacatatggcactgattacatacaaaatcttaacctactacaatgctaa

DBGET integrated database retrieval system