Oryx dammah (scimitar-horned oryx): 120851376 Help Entry 120851376         CDS       T07255                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04010   MAPK signaling pathway oda04020   Calcium signaling pathway oda04022   cGMP-PKG signaling pathway oda04114   Oocyte meiosis oda04218   Cellular senescence oda04310   Wnt signaling pathway oda04360   Axon guidance oda04370   VEGF signaling pathway oda04380   Osteoclast differentiation oda04625   C-type lectin receptor signaling pathway oda04650   Natural killer cell mediated cytotoxicity oda04658   Th1 and Th2 cell differentiation oda04659   Th17 cell differentiation oda04660   T cell receptor signaling pathway oda04662   B cell receptor signaling pathway oda04720   Long-term potentiation oda04724   Glutamatergic synapse oda04921   Oxytocin signaling pathway oda04922   Glucagon signaling pathway oda04924   Renin secretion oda05010   Alzheimer disease oda05014   Amyotrophic lateral sclerosis oda05020   Prion disease oda05022   Pathways of neurodegeneration - multiple diseases oda05031   Amphetamine addiction oda05152   Tuberculosis oda05163   Human cytomegalovirus infection oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05170   Human immunodeficiency virus 1 infection oda05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120851376 (PPP3R1)    04310 Wnt signaling pathway     120851376 (PPP3R1)    04370 VEGF signaling pathway     120851376 (PPP3R1)    04020 Calcium signaling pathway     120851376 (PPP3R1)    04022 cGMP-PKG signaling pathway     120851376 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120851376 (PPP3R1)    04218 Cellular senescence     120851376 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120851376 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     120851376 (PPP3R1)    04660 T cell receptor signaling pathway     120851376 (PPP3R1)    04658 Th1 and Th2 cell differentiation     120851376 (PPP3R1)    04659 Th17 cell differentiation     120851376 (PPP3R1)    04662 B cell receptor signaling pathway     120851376 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     120851376 (PPP3R1)    04921 Oxytocin signaling pathway     120851376 (PPP3R1)    04924 Renin secretion     120851376 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     120851376 (PPP3R1)    04720 Long-term potentiation     120851376 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     120851376 (PPP3R1)    04380 Osteoclast differentiation     120851376 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120851376 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120851376 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     120851376 (PPP3R1)    05163 Human cytomegalovirus infection     120851376 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     120851376 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     120851376 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     120851376 (PPP3R1)    05014 Amyotrophic lateral sclerosis     120851376 (PPP3R1)    05020 Prion disease     120851376 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     120851376 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     120851376 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120851376 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oda01009]     120851376 (PPP3R1) Protein phosphatases and associated proteins [BR:oda01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120851376 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  120851376 NCBI-ProteinID:  XP_040080053 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctacctgagttacaacagaatcccttagtacagcgagtaatagat atattcgacacagatgggaatggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg gggaacaatctgaaagacacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggggatggaagaatatcctttgaagaattttgtgctgttgtaggcggccta gatatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system