Oryx dammah (scimitar-horned oryx): 120851459 Help Entry 120851459         CDS       T07255                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01523   Antifolate resistance oda04010   MAPK signaling pathway oda04060   Cytokine-cytokine receptor interaction oda04064   NF-kappa B signaling pathway oda04217   Necroptosis oda04380   Osteoclast differentiation oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04625   C-type lectin receptor signaling pathway oda04640   Hematopoietic cell lineage oda04657   IL-17 signaling pathway oda04659   Th17 cell differentiation oda04668   TNF signaling pathway oda04750   Inflammatory mediator regulation of TRP channels oda04932   Non-alcoholic fatty liver disease oda04933   AGE-RAGE signaling pathway in diabetic complications oda04936   Alcoholic liver disease oda04940   Type I diabetes mellitus oda05010   Alzheimer disease oda05020   Prion disease oda05022   Pathways of neurodegeneration - multiple diseases oda05132   Salmonella infection oda05133   Pertussis oda05134   Legionellosis oda05135   Yersinia infection oda05140   Leishmaniasis oda05142   Chagas disease oda05143   African trypanosomiasis oda05144   Malaria oda05146   Amoebiasis oda05152   Tuberculosis oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05168   Herpes simplex virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05321   Inflammatory bowel disease oda05323   Rheumatoid arthritis oda05332   Graft-versus-host disease oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120851459 (IL1B)    04064 NF-kappa B signaling pathway     120851459 (IL1B)    04668 TNF signaling pathway     120851459 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120851459 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120851459 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120851459 (IL1B)    04620 Toll-like receptor signaling pathway     120851459 (IL1B)    04621 NOD-like receptor signaling pathway     120851459 (IL1B)    04623 Cytosolic DNA-sensing pathway     120851459 (IL1B)    04625 C-type lectin receptor signaling pathway     120851459 (IL1B)    04659 Th17 cell differentiation     120851459 (IL1B)    04657 IL-17 signaling pathway     120851459 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     120851459 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     120851459 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     120851459 (IL1B)    05164 Influenza A     120851459 (IL1B)    05162 Measles     120851459 (IL1B)    05168 Herpes simplex virus 1 infection     120851459 (IL1B)    05163 Human cytomegalovirus infection     120851459 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     120851459 (IL1B)    05135 Yersinia infection     120851459 (IL1B)    05133 Pertussis     120851459 (IL1B)    05134 Legionellosis     120851459 (IL1B)    05152 Tuberculosis     120851459 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     120851459 (IL1B)    05144 Malaria     120851459 (IL1B)    05140 Leishmaniasis     120851459 (IL1B)    05142 Chagas disease     120851459 (IL1B)    05143 African trypanosomiasis     120851459 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     120851459 (IL1B)    05321 Inflammatory bowel disease     120851459 (IL1B)    05332 Graft-versus-host disease     120851459 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     120851459 (IL1B)    05020 Prion disease     120851459 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     120851459 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120851459 (IL1B)    05418 Fluid shear stress and atherosclerosis     120851459 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120851459 (IL1B)    04936 Alcoholic liver disease     120851459 (IL1B)    04932 Non-alcoholic fatty liver disease     120851459 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     120851459 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120851459 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120851459 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:oda00536]     120851459 (IL1B) Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interleukins    120851459 (IL1B) Glycosaminoglycan binding proteins [BR:oda00536]  Heparan sulfate / Heparin   Cytokines    120851459 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  120851459 NCBI-ProteinID:  XP_040080160 LinkDB All DBs Position Unknown AA seq 266 aa AA seqDB search MATVPEPINEMMAYYSDENELLFEADGPKQMKSCTQHLDLGSMGDGNIQLQISHQLYNKS FRQVVSVIVAMEKLRSHAYAHVFHDDDLRSILSFIFEEEPVILETSSDELLCDAAVQSVK CKLQDREQKSLVLASPCVLKALHLLSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNL YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESLLYPNWYISTSQI EEKPVFLGHFRGGQDITDFRMETLSP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaaccgtacctgaacccattaatgaaatgatggcttactacagtgatgagaatgag ctgttatttgaggctgatggccccaaacagatgaagagctgcacccaacacctggacctc ggctccatgggagatggaaacatccagctgcagatttctcaccagctctacaacaaaagc ttcaggcaggtggtgtcggtcatcgtggccatggagaagctgaggagccatgcctacgca catgtcttccatgatgatgacctgaggagcatcctttcattcatcttcgaagaagagcct gtcatcttagaaacatcctccgacgagcttctgtgtgacgcagccgtgcagtcagtaaaa tgcaaactccaggacagagagcaaaaatccctggtgctggctagcccatgtgtgctgaag gctctccacctcctctcacaggaaatgagccgagaagtggtgttctgcatgagcttcgta caaggagaggaaagagacaacaagattcctgtggccttgggtatcagggacaagaatcta tacctgtcttgtgtgaaaaaaggtgatacgcccaccctgcagctggaggaagtagacccc aaagtctaccccaagaggaatatggaaaagcgatttgtcttctacaagacagaaatcaag aatacagttgaatttgagtctctcctgtaccctaactggtatatcagcacttctcaaatt gaagaaaagcccgtcttcctgggacattttagaggtggccaggatataactgacttcaga atggaaaccctctctccctaa

DBGET integrated database retrieval system