Oryx dammah (scimitar-horned oryx): 120851613 Help Entry 120851613         CDS       T07255                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04015   Rap1 signaling pathway oda04810   Regulation of actin cytoskeleton oda05014   Amyotrophic lateral sclerosis oda05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     120851613 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120851613 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120851613 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120851613 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120851613 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oda04812]     120851613 (PFN4)    04147 Exosome [BR:oda04147]     120851613 (PFN4) Membrane trafficking [BR:oda04131]  Others   Actin-binding proteins    Others     120851613 (PFN4) Cytoskeleton proteins [BR:oda04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120851613 (PFN4) Exosome [BR:oda04147]  Exosomal proteins   Proteins found in most exosomes    120851613 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120851613 NCBI-ProteinID:  XP_040080461 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaaaaaccctttgaagaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system