Oryx dammah (scimitar-horned oryx): 120855806
Help
Entry
120855806 CDS
T07255
Name
(RefSeq) superoxide dismutase [Cu-Zn]-like
KO
K04565
superoxide dismutase, Cu-Zn family [EC:
1.15.1.1
]
Organism
oda
Oryx dammah (scimitar-horned oryx)
Pathway
oda04146
Peroxisome
oda04213
Longevity regulating pathway - multiple species
oda05012
Parkinson disease
oda05014
Amyotrophic lateral sclerosis
oda05016
Huntington disease
oda05020
Prion disease
oda05022
Pathways of neurodegeneration - multiple diseases
oda05208
Chemical carcinogenesis - reactive oxygen species
Brite
KEGG Orthology (KO) [BR:
oda00001
]
09140 Cellular Processes
09141 Transport and catabolism
04146 Peroxisome
120855806
09150 Organismal Systems
09149 Aging
04213 Longevity regulating pathway - multiple species
120855806
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
120855806
09164 Neurodegenerative disease
05012 Parkinson disease
120855806
05014 Amyotrophic lateral sclerosis
120855806
05016 Huntington disease
120855806
05020 Prion disease
120855806
05022 Pathways of neurodegeneration - multiple diseases
120855806
Enzymes [BR:
oda01000
]
1. Oxidoreductases
1.15 Acting on superoxide as acceptor
1.15.1 Acting on superoxide as acceptor (only sub-subclass identified to date)
1.15.1.1 superoxide dismutase
120855806
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Sod_Cu
Motif
Other DBs
NCBI-GeneID:
120855806
NCBI-ProteinID:
XP_040086503
LinkDB
All DBs
Position
Unknown
AA seq
140 aa
AA seq
DB search
MATKAVCVLKGDGPVQGTIHFEAKGNTVVVTGLTEDDHGFHVHQFGDNTQGCTSAGPHFN
PLSKKHGGPKDEERHFGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGHTMVVHEKPDD
LGRGGNEESTKTGNAGSRLA
NT seq
423 nt
NT seq
+upstream
nt +downstream
nt
atggcgacgaaggccgtctgcgtgctgaagggtgatggcccagtgcaaggcaccatccac
ttcgaggcaaagggaaatacagtcgtggtaactgggttgactgaagatgatcatggattc
cacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggtcctcactttaat
cctctgtccaaaaaacatggtggcccaaaggatgaagagaggcattttggagacctgggc
aatgtgacggctgacaaaaatggtgttgccattgtggatattgtagatcctttgatctca
ctctcaggagaatattccatcattggccacacaatggtggttcatgaaaaaccagatgac
ttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctggaagtcgtttggcc
tga
DBGET
integrated database retrieval system