Oryx dammah (scimitar-horned oryx): 120855861 Help Entry 120855861         CDS       T07255                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04382   Cornified envelope formation oda05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oda00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120855861 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120855861 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120855861 (S100A10) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of microglial cells    120855861 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  120855861 NCBI-ProteinID:  XP_040086595 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacatttcacaaatttgca ggtgataaaggttacttaacaaaggaagacctcagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgtcgagatggcaaagtgggcttccagagcttcttttcgctaatcgctgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system