Oryx dammah (scimitar-horned oryx): 120856043 Help Entry 120856043         CDS       T07255                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01521   EGFR tyrosine kinase inhibitor resistance oda01522   Endocrine resistance oda04010   MAPK signaling pathway oda04012   ErbB signaling pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04062   Chemokine signaling pathway oda04068   FoxO signaling pathway oda04071   Sphingolipid signaling pathway oda04072   Phospholipase D signaling pathway oda04137   Mitophagy - animal oda04140   Autophagy - animal oda04150   mTOR signaling pathway oda04151   PI3K-Akt signaling pathway oda04210   Apoptosis oda04211   Longevity regulating pathway oda04213   Longevity regulating pathway - multiple species oda04218   Cellular senescence oda04360   Axon guidance oda04370   VEGF signaling pathway oda04371   Apelin signaling pathway oda04540   Gap junction oda04550   Signaling pathways regulating pluripotency of stem cells oda04625   C-type lectin receptor signaling pathway oda04650   Natural killer cell mediated cytotoxicity oda04660   T cell receptor signaling pathway oda04662   B cell receptor signaling pathway oda04664   Fc epsilon RI signaling pathway oda04714   Thermogenesis oda04720   Long-term potentiation oda04722   Neurotrophin signaling pathway oda04725   Cholinergic synapse oda04726   Serotonergic synapse oda04730   Long-term depression oda04810   Regulation of actin cytoskeleton oda04910   Insulin signaling pathway oda04912   GnRH signaling pathway oda04915   Estrogen signaling pathway oda04916   Melanogenesis oda04917   Prolactin signaling pathway oda04919   Thyroid hormone signaling pathway oda04921   Oxytocin signaling pathway oda04926   Relaxin signaling pathway oda04929   GnRH secretion oda04933   AGE-RAGE signaling pathway in diabetic complications oda04935   Growth hormone synthesis, secretion and action oda05010   Alzheimer disease oda05022   Pathways of neurodegeneration - multiple diseases oda05034   Alcoholism oda05160   Hepatitis C oda05161   Hepatitis B oda05163   Human cytomegalovirus infection oda05165   Human papillomavirus infection oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05170   Human immunodeficiency virus 1 infection oda05200   Pathways in cancer oda05203   Viral carcinogenesis oda05205   Proteoglycans in cancer oda05206   MicroRNAs in cancer oda05207   Chemical carcinogenesis - receptor activation oda05208   Chemical carcinogenesis - reactive oxygen species oda05210   Colorectal cancer oda05211   Renal cell carcinoma oda05213   Endometrial cancer oda05214   Glioma oda05215   Prostate cancer oda05216   Thyroid cancer oda05218   Melanoma oda05219   Bladder cancer oda05220   Chronic myeloid leukemia oda05221   Acute myeloid leukemia oda05223   Non-small cell lung cancer oda05224   Breast cancer oda05225   Hepatocellular carcinoma oda05226   Gastric cancer oda05230   Central carbon metabolism in cancer oda05231   Choline metabolism in cancer oda05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120856043 (NRAS)    04012 ErbB signaling pathway     120856043 (NRAS)    04014 Ras signaling pathway     120856043 (NRAS)    04015 Rap1 signaling pathway     120856043 (NRAS)    04370 VEGF signaling pathway     120856043 (NRAS)    04371 Apelin signaling pathway     120856043 (NRAS)    04068 FoxO signaling pathway     120856043 (NRAS)    04072 Phospholipase D signaling pathway     120856043 (NRAS)    04071 Sphingolipid signaling pathway     120856043 (NRAS)    04151 PI3K-Akt signaling pathway     120856043 (NRAS)    04150 mTOR signaling pathway     120856043 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120856043 (NRAS)    04137 Mitophagy - animal     120856043 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120856043 (NRAS)    04218 Cellular senescence     120856043 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120856043 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     120856043 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120856043 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120856043 (NRAS)    04650 Natural killer cell mediated cytotoxicity     120856043 (NRAS)    04660 T cell receptor signaling pathway     120856043 (NRAS)    04662 B cell receptor signaling pathway     120856043 (NRAS)    04664 Fc epsilon RI signaling pathway     120856043 (NRAS)    04062 Chemokine signaling pathway     120856043 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120856043 (NRAS)    04929 GnRH secretion     120856043 (NRAS)    04912 GnRH signaling pathway     120856043 (NRAS)    04915 Estrogen signaling pathway     120856043 (NRAS)    04917 Prolactin signaling pathway     120856043 (NRAS)    04921 Oxytocin signaling pathway     120856043 (NRAS)    04926 Relaxin signaling pathway     120856043 (NRAS)    04935 Growth hormone synthesis, secretion and action     120856043 (NRAS)    04919 Thyroid hormone signaling pathway     120856043 (NRAS)    04916 Melanogenesis     120856043 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     120856043 (NRAS)    04726 Serotonergic synapse     120856043 (NRAS)    04720 Long-term potentiation     120856043 (NRAS)    04730 Long-term depression     120856043 (NRAS)    04722 Neurotrophin signaling pathway     120856043 (NRAS)   09158 Development and regeneration    04360 Axon guidance     120856043 (NRAS)   09149 Aging    04211 Longevity regulating pathway     120856043 (NRAS)    04213 Longevity regulating pathway - multiple species     120856043 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     120856043 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120856043 (NRAS)    05206 MicroRNAs in cancer     120856043 (NRAS)    05205 Proteoglycans in cancer     120856043 (NRAS)    05207 Chemical carcinogenesis - receptor activation     120856043 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     120856043 (NRAS)    05203 Viral carcinogenesis     120856043 (NRAS)    05230 Central carbon metabolism in cancer     120856043 (NRAS)    05231 Choline metabolism in cancer     120856043 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120856043 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     120856043 (NRAS)    05225 Hepatocellular carcinoma     120856043 (NRAS)    05226 Gastric cancer     120856043 (NRAS)    05214 Glioma     120856043 (NRAS)    05216 Thyroid cancer     120856043 (NRAS)    05221 Acute myeloid leukemia     120856043 (NRAS)    05220 Chronic myeloid leukemia     120856043 (NRAS)    05218 Melanoma     120856043 (NRAS)    05211 Renal cell carcinoma     120856043 (NRAS)    05219 Bladder cancer     120856043 (NRAS)    05215 Prostate cancer     120856043 (NRAS)    05213 Endometrial cancer     120856043 (NRAS)    05224 Breast cancer     120856043 (NRAS)    05223 Non-small cell lung cancer     120856043 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120856043 (NRAS)    05170 Human immunodeficiency virus 1 infection     120856043 (NRAS)    05161 Hepatitis B     120856043 (NRAS)    05160 Hepatitis C     120856043 (NRAS)    05163 Human cytomegalovirus infection     120856043 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     120856043 (NRAS)    05165 Human papillomavirus infection     120856043 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120856043 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     120856043 (NRAS)   09165 Substance dependence    05034 Alcoholism     120856043 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120856043 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     120856043 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120856043 (NRAS)    01522 Endocrine resistance     120856043 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120856043 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120856043 (NRAS)    04031 GTP-binding proteins [BR:oda04031]     120856043 (NRAS) Membrane trafficking [BR:oda04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120856043 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120856043 (NRAS) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120856043 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120856043 (NRAS)   Exosomal proteins of breast cancer cells    120856043 (NRAS)   Exosomal proteins of colorectal cancer cells    120856043 (NRAS) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120856043 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  120856043 NCBI-ProteinID:  XP_040086913 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGSQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgacttg ccaacaaggacagttgacacaaaacaagcccatgaattggccaaaagctatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcagtcaaggt tgtatggggttgccatgtgtggtaatgtaa

DBGET integrated database retrieval system