Oryx dammah (scimitar-horned oryx): 120858887 Help Entry 120858887         CDS       T07255                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04613   Neutrophil extracellular trap formation oda05034   Alcoholism oda05203   Viral carcinogenesis oda05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oda00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120858887  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     120858887   09163 Immune disease    05322 Systemic lupus erythematosus     120858887   09165 Substance dependence    05034 Alcoholism     120858887  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oda03036]     120858887 Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120858887 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  120858887 NCBI-ProteinID:  XP_040091174 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggcaggggcaaaggagggaaagggctgggtaaaggaggtgccaagcgtcaccgg aaggtcttacgggacaacatccagggcattacgaagcccgcaattcgccgtcttgcccgc cgtggtggtgtcaagcgcatctcagggctcatctacgaggagacccgtggagtgctcaaa gtgttcttggaaaatgtgatccgcgatgcagtgacgtacacggaacacgccaagcgcaag acggtcacggccatggatgtggtgtatgctctgaaacgccagggccgcaccctctacggc ttcggtggctga

DBGET integrated database retrieval system