Oryx dammah (scimitar-horned oryx): 120860983 Help Entry 120860983         CDS       T07255                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04068   FoxO signaling pathway oda04136   Autophagy - other oda04140   Autophagy - animal oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     120860983  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120860983    04136 Autophagy - other     120860983  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120860983    04622 RIG-I-like receptor signaling pathway     120860983  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120860983    04121 Ubiquitin system [BR:oda04121]     120860983    03029 Mitochondrial biogenesis [BR:oda03029]     120860983 Membrane trafficking [BR:oda04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     120860983 Ubiquitin system [BR:oda04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    120860983 Mitochondrial biogenesis [BR:oda03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     120860983 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  120860983 NCBI-ProteinID:  XP_040092628 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEEQESALQLPPSTAPEAEVPTEVSPETATPEPPSSAAVSPGTEEPVGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagcaagagtctgcgctgcagctccctccctctactgctcccgaagctgaa gtgcctaccgaggtctccccagaaacagccactccggagcccccttcttctgctgcagtc tctccgggaacagaggaacctgtcggtgacaccaagaaaaaaattgacattctgctaaag gctgtgggagacactcctataatgaaaacaaagaaatgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttccttaaacttgtggcttcagaacagttg tttatttacgtgaatcagtcctttgccccctccccagaccaggaagttgggaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaagcatgggga tga

DBGET integrated database retrieval system