Oryx dammah (scimitar-horned oryx): 120862199 Help Entry 120862199         CDS       T07255                                  Name (RefSeq) interferon alpha-H   KO K05414   interferon alpha Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04151   PI3K-Akt signaling pathway oda04217   Necroptosis oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04630   JAK-STAT signaling pathway oda04650   Natural killer cell mediated cytotoxicity oda04936   Alcoholic liver disease oda05152   Tuberculosis oda05160   Hepatitis C oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05165   Human papillomavirus infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05200   Pathways in cancer oda05320   Autoimmune thyroid disease oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120862199    04151 PI3K-Akt signaling pathway     120862199   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120862199  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120862199  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120862199    04621 NOD-like receptor signaling pathway     120862199    04622 RIG-I-like receptor signaling pathway     120862199    04623 Cytosolic DNA-sensing pathway     120862199    04650 Natural killer cell mediated cytotoxicity     120862199  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120862199   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120862199    05161 Hepatitis B     120862199    05160 Hepatitis C     120862199    05171 Coronavirus disease - COVID-19     120862199    05164 Influenza A     120862199    05162 Measles     120862199    05168 Herpes simplex virus 1 infection     120862199    05163 Human cytomegalovirus infection     120862199    05167 Kaposi sarcoma-associated herpesvirus infection     120862199    05169 Epstein-Barr virus infection     120862199    05165 Human papillomavirus infection     120862199   09171 Infectious disease: bacterial    05152 Tuberculosis     120862199   09163 Immune disease    05320 Autoimmune thyroid disease     120862199   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120862199   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120862199  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120862199 Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interferons    120862199 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  120862199 NCBI-ProteinID:  XP_040094256 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MAPAWSLLQALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFGSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactccaggctctgctgcttctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcactgggtggtagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcgacaaac ttgcaggagagattcgggagcaaggactga

DBGET integrated database retrieval system