Oryx dammah (scimitar-horned oryx): 120864186 Help Entry 120864186         CDS       T07255                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04140   Autophagy - animal oda04144   Endocytosis oda04152   AMPK signaling pathway oda04530   Tight junction oda04972   Pancreatic secretion oda05014   Amyotrophic lateral sclerosis oda05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     120864186 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120864186 (RAB8A)    04140 Autophagy - animal     120864186 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     120864186 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     120864186 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120864186 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     120864186 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120864186 (RAB8A)    03036 Chromosome and associated proteins [BR:oda03036]     120864186 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120864186 (RAB8A)    04031 GTP-binding proteins [BR:oda04031]     120864186 (RAB8A) Membrane trafficking [BR:oda04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     120864186 (RAB8A)  Autophagy   Other autophagy associated proteins     120864186 (RAB8A) Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120864186 (RAB8A) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120864186 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    120864186 (RAB8A)   Exosomal proteins of colorectal cancer cells    120864186 (RAB8A) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     120864186 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  120864186 NCBI-ProteinID:  XP_040096976 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgataacatccgg aactggattcggaacattgaagagcatgcctctgcagacgtggaaaagatgatccttggg aacaagtgcgacgtgaacgacaagagacaagtttccaaggagcggggagaaaagctggcc ctggactatggaatcaagttcatggagacaagcgcaaaggccaacatcaacgtggagaac gcattttacactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcaccccggaccagcagaagaggagcagc ttcttccgatgtgttcttctgtga

DBGET integrated database retrieval system