Oryx dammah (scimitar-horned oryx): 120864746 Help Entry 120864746         CDS       T07255                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04630   JAK-STAT signaling pathway oda04640   Hematopoietic cell lineage oda04657   IL-17 signaling pathway oda04658   Th1 and Th2 cell differentiation oda04660   T cell receptor signaling pathway oda04664   Fc epsilon RI signaling pathway oda04672   Intestinal immune network for IgA production oda05200   Pathways in cancer oda05310   Asthma oda05320   Autoimmune thyroid disease oda05321   Inflammatory bowel disease oda05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120864746 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120864746 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120864746 (IL5)    04660 T cell receptor signaling pathway     120864746 (IL5)    04658 Th1 and Th2 cell differentiation     120864746 (IL5)    04657 IL-17 signaling pathway     120864746 (IL5)    04664 Fc epsilon RI signaling pathway     120864746 (IL5)    04672 Intestinal immune network for IgA production     120864746 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120864746 (IL5)   09163 Immune disease    05310 Asthma     120864746 (IL5)    05320 Autoimmune thyroid disease     120864746 (IL5)    05321 Inflammatory bowel disease     120864746 (IL5)    05330 Allograft rejection     120864746 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120864746 (IL5)    00536 Glycosaminoglycan binding proteins [BR:oda00536]     120864746 (IL5) Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interleukins    120864746 (IL5) Glycosaminoglycan binding proteins [BR:oda00536]  Heparan sulfate / Heparin   Cytokines    120864746 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  120864746 NCBI-ProteinID:  XP_040097758 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSTHRTLLIGDGNLMIPTPQHTNH QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVNQFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcatctgcatttgactttggtagctcttggagctgcctatgtttgtgccaat gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctccactcat cgaactctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac caactatgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc caaaaaaggaagtgtggaggagaaagatggagagtgaaccaattcctagactacctgcaa gtttttcttggtgtgataaacacagagtggacaatggaaagttga

DBGET integrated database retrieval system