Oryx dammah (scimitar-horned oryx): 120866075 Help Entry 120866075         CDS       T07255                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda03272   Virion - Hepatitis viruses oda04382   Cornified envelope formation oda04514   Cell adhesion molecules oda04530   Tight junction oda04670   Leukocyte transendothelial migration oda05160   Hepatitis C Brite KEGG Orthology (KO) [BR:oda00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     120866075 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     120866075 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     120866075 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     120866075 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     120866075 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     120866075 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oda03037]     120866075 (CLDN7)    04147 Exosome [BR:oda04147]     120866075 (CLDN7)    04515 Cell adhesion molecules [BR:oda04515]     120866075 (CLDN7) Cilium and associated proteins [BR:oda03037]  Other cilia and associated proteins   Stereociliary proteins    120866075 (CLDN7) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    120866075 (CLDN7)   Exosomal proteins of colorectal cancer cells    120866075 (CLDN7) Cell adhesion molecules [BR:oda04515]  Immunoglobulin superfamily   L1 family    120866075 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like OppC_N HemY_N Motif Other DBs NCBI-GeneID:  120866075 NCBI-ProteinID:  XP_040099476 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANSGLQLLGFSMALVGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagctgctgggcttttccatggctctggtgggctgggtgggc ctggtggcatgcacggccatcccgcagtggcagatgagctcgtacgctggcgacaatatc atcaccgcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcaccggc atgatgagctgcaaaatgtacgactcggtgctctccctgccggcggccttgcaggccact cgagccctaatggtggtctccctggtgctgggcttcctggccacattcgtggccacgatg ggcatgaagtgtaccaactgtgggggagacgacaaagtgaagaaggcccggatagccatg acgggaggcatcattttcatcttggcaggtcttgctgccttgatagcttgctcctggtac ggccatcagattgtctcagatttctataacccgttggtccccatgaatgttaagtatgaa tttggtcctgccatcttcattggctgggcagggtctgctctggtcctcctgggaggtgca ctgctctcttgctcctgtcctgggagtgagagcaaagctggataccgtgcgcctcgctcc taccctaagcccaactctgccaaggagtacgtgtga

DBGET integrated database retrieval system