Oryx dammah (scimitar-horned oryx): 120866382 Help Entry 120866382         CDS       T07255                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04061   Viral protein interaction with cytokine and cytokine receptor oda04062   Chemokine signaling pathway oda04620   Toll-like receptor signaling pathway oda05142   Chagas disease oda05163   Human cytomegalovirus infection oda05323   Rheumatoid arthritis oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120866382    04061 Viral protein interaction with cytokine and cytokine receptor     120866382  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120866382    04062 Chemokine signaling pathway     120866382  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     120866382   09174 Infectious disease: parasitic    05142 Chagas disease     120866382   09163 Immune disease    05323 Rheumatoid arthritis     120866382   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120866382  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120866382    00536 Glycosaminoglycan binding proteins [BR:oda00536]     120866382 Cytokines and neuropeptides [BR:oda04052]  Cytokines   Chemokines    120866382 Glycosaminoglycan binding proteins [BR:oda00536]  Heparan sulfate / Heparin   Chemokines    120866382 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF6211 Motif Other DBs NCBI-GeneID:  120866382 NCBI-ProteinID:  XP_040100007 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MRVSLAALAFLLTLAILHSEANEEPADNQRVCCFASVTRAIRLSFVKNYQRTSDQCPQPG VIFQTRNGQLICADPGQAWVQKYIKYLDQKSKGAGNSGTFTVEGK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgagggtcagcctggccgccctggccttcctcctcactcttgccatcctgcactcggag gccaatgaagaaccagctgataaccagcgtgtctgctgtttcgcctcggtaacaagggca atccgactctctttcgtgaaaaattatcaaaggaccagtgaccagtgcccccagccaggg gtcatcttccagaccagaaatgggcaattgatctgtgctgacccaggccaggcctgggta cagaagtacatcaaatacctggaccaaaagtccaagggagctgggaacagtgggaccttc acagtcgagggaaaatga

DBGET integrated database retrieval system