Oryx dammah (scimitar-horned oryx): 120867130 Help Entry 120867130         CDS       T07255                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04014   Ras signaling pathway oda04137   Mitophagy - animal oda04144   Endocytosis oda04145   Phagosome oda04148   Efferocytosis oda04962   Vasopressin-regulated water reabsorption oda05132   Salmonella infection oda05146   Amoebiasis oda05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120867130 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120867130 (RAB5C)    04145 Phagosome     120867130 (RAB5C)    04137 Mitophagy - animal     120867130 (RAB5C)    04148 Efferocytosis     120867130 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     120867130 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120867130 (RAB5C)    05152 Tuberculosis     120867130 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     120867130 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120867130 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120867130 (RAB5C)    04031 GTP-binding proteins [BR:oda04031]     120867130 (RAB5C) Membrane trafficking [BR:oda04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     120867130 (RAB5C)  Endosome - Lysosome transport     120867130 (RAB5C) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120867130 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    120867130 (RAB5C)   Exosomal proteins of colorectal cancer cells    120867130 (RAB5C)   Exosomal proteins of bladder cancer cells    120867130 (RAB5C) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     120867130 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  120867130 NCBI-ProteinID:  XP_040101286 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcggtgggcaaatccagcctcgtcctccgc ttcgtcaagggtcagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacctttgcacgggccaagaactgggtgaaggagttacag aggcaggccagccccaacatcgtcatcgcacttgcaggcaacaaggcagacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgaaccccagaatgcagctggtgctccgggccggaaccgaggcgtg gacctccaggagaacaaccccgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system