Oryx dammah (scimitar-horned oryx): 120867140 Help Entry 120867140         CDS       T07255                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04081   Hormone signaling oda04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     120867140 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     120867140 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120867140 (GAST) Cytokines and neuropeptides [BR:oda04052]  Neuropeptides   GPCR binding    120867140 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  120867140 NCBI-ProteinID:  XP_040101301 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSQLQDVPIAPGANRGQEPLRMDRLGPAWHPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaaaccccattcccagctgcaagacgtgcccatcgctccaggggccaacagg ggccaggagccgctcaggatggaccggctgggcccagcctggcacccccgcaggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccgtgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacacccctga

DBGET integrated database retrieval system