Oryx dammah (scimitar-horned oryx): 120867683 Help Entry 120867683         CDS       T07255                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04144   Endocytosis oda04510   Focal adhesion oda05020   Prion disease oda05100   Bacterial invasion of epithelial cells oda05205   Proteoglycans in cancer oda05410   Hypertrophic cardiomyopathy oda05412   Arrhythmogenic right ventricular cardiomyopathy oda05414   Dilated cardiomyopathy oda05416   Viral myocarditis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120867683 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120867683 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     120867683 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120867683 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     120867683 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     120867683 (CAV3)    05410 Hypertrophic cardiomyopathy     120867683 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     120867683 (CAV3)    05414 Dilated cardiomyopathy     120867683 (CAV3)    05416 Viral myocarditis     120867683 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120867683 (CAV3) Membrane trafficking [BR:oda04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     120867683 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  120867683 NCBI-ProteinID:  XP_040101928 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEERTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcgcacagacctggaagcccagatcgtcaaggacattcacttcaag gagatcgatctggtgaaccgggaccctaagaacatcaacgaggacatagtgaaggtggat tttgaagacgtgatcgcggagcccgtgggcacctacagctttgacggcgtgtggaaggtg agctacaccaccttcactgtctccaagtactggtgctaccgcctgctgtccacactgctg ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccctgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactcactctgcatccgcaccttctgcaacccactcttcgccgccctgggccaggtctgc agcaacatcaaggtgatgctgcggaaggaagtgtga

DBGET integrated database retrieval system