Oryx dammah (scimitar-horned oryx): 120868267 Help Entry 120868267         CDS       T07255                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04022   cGMP-PKG signaling pathway oda04024   cAMP signaling pathway oda04062   Chemokine signaling pathway oda04071   Sphingolipid signaling pathway oda04072   Phospholipase D signaling pathway oda04081   Hormone signaling oda04144   Endocytosis oda04150   mTOR signaling pathway oda04270   Vascular smooth muscle contraction oda04310   Wnt signaling pathway oda04350   TGF-beta signaling pathway oda04360   Axon guidance oda04510   Focal adhesion oda04517   IgSF CAM signaling oda04519   Cadherin signaling oda04520   Adherens junction oda04530   Tight junction oda04611   Platelet activation oda04621   NOD-like receptor signaling pathway oda04625   C-type lectin receptor signaling pathway oda04660   T cell receptor signaling pathway oda04670   Leukocyte transendothelial migration oda04722   Neurotrophin signaling pathway oda04810   Regulation of actin cytoskeleton oda04921   Oxytocin signaling pathway oda04928   Parathyroid hormone synthesis, secretion and action oda04972   Pancreatic secretion oda05100   Bacterial invasion of epithelial cells oda05132   Salmonella infection oda05133   Pertussis oda05135   Yersinia infection oda05152   Tuberculosis oda05163   Human cytomegalovirus infection oda05200   Pathways in cancer oda05203   Viral carcinogenesis oda05205   Proteoglycans in cancer oda05206   MicroRNAs in cancer oda05210   Colorectal cancer oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120868267 (RHOA)    04015 Rap1 signaling pathway     120868267 (RHOA)    04310 Wnt signaling pathway     120868267 (RHOA)    04350 TGF-beta signaling pathway     120868267 (RHOA)    04072 Phospholipase D signaling pathway     120868267 (RHOA)    04071 Sphingolipid signaling pathway     120868267 (RHOA)    04024 cAMP signaling pathway     120868267 (RHOA)    04022 cGMP-PKG signaling pathway     120868267 (RHOA)    04150 mTOR signaling pathway     120868267 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     120868267 (RHOA)    04517 IgSF CAM signaling     120868267 (RHOA)    04519 Cadherin signaling     120868267 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120868267 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120868267 (RHOA)    04520 Adherens junction     120868267 (RHOA)    04530 Tight junction     120868267 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120868267 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     120868267 (RHOA)    04621 NOD-like receptor signaling pathway     120868267 (RHOA)    04625 C-type lectin receptor signaling pathway     120868267 (RHOA)    04660 T cell receptor signaling pathway     120868267 (RHOA)    04670 Leukocyte transendothelial migration     120868267 (RHOA)    04062 Chemokine signaling pathway     120868267 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     120868267 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     120868267 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     120868267 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     120868267 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120868267 (RHOA)   09158 Development and regeneration    04360 Axon guidance     120868267 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120868267 (RHOA)    05206 MicroRNAs in cancer     120868267 (RHOA)    05205 Proteoglycans in cancer     120868267 (RHOA)    05203 Viral carcinogenesis     120868267 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     120868267 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     120868267 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120868267 (RHOA)    05135 Yersinia infection     120868267 (RHOA)    05133 Pertussis     120868267 (RHOA)    05152 Tuberculosis     120868267 (RHOA)    05100 Bacterial invasion of epithelial cells     120868267 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120868267 (RHOA)    05418 Fluid shear stress and atherosclerosis     120868267 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120868267 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120868267 (RHOA)    04031 GTP-binding proteins [BR:oda04031]     120868267 (RHOA) Membrane trafficking [BR:oda04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120868267 (RHOA) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120868267 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    120868267 (RHOA)   Exosomal proteins of colorectal cancer cells    120868267 (RHOA)   Exosomal proteins of bladder cancer cells    120868267 (RHOA) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120868267 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120868267 NCBI-ProteinID:  XP_040102948 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacagtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system