Oryx dammah (scimitar-horned oryx): 120868762 Help Entry 120868762         CDS       T07255                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01521   EGFR tyrosine kinase inhibitor resistance oda01524   Platinum drug resistance oda04014   Ras signaling pathway oda04064   NF-kappa B signaling pathway oda04115   p53 signaling pathway oda04137   Mitophagy - animal oda04140   Autophagy - animal oda04151   PI3K-Akt signaling pathway oda04210   Apoptosis oda04215   Apoptosis - multiple species oda04621   NOD-like receptor signaling pathway oda04630   JAK-STAT signaling pathway oda05012   Parkinson disease oda05014   Amyotrophic lateral sclerosis oda05022   Pathways of neurodegeneration - multiple diseases oda05145   Toxoplasmosis oda05162   Measles oda05166   Human T-cell leukemia virus 1 infection oda05168   Herpes simplex virus 1 infection oda05170   Human immunodeficiency virus 1 infection oda05200   Pathways in cancer oda05202   Transcriptional misregulation in cancer oda05212   Pancreatic cancer oda05220   Chronic myeloid leukemia oda05222   Small cell lung cancer oda05225   Hepatocellular carcinoma oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120868762 (BCL2L1)    04630 JAK-STAT signaling pathway     120868762 (BCL2L1)    04064 NF-kappa B signaling pathway     120868762 (BCL2L1)    04151 PI3K-Akt signaling pathway     120868762 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120868762 (BCL2L1)    04137 Mitophagy - animal     120868762 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     120868762 (BCL2L1)    04215 Apoptosis - multiple species     120868762 (BCL2L1)    04115 p53 signaling pathway     120868762 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120868762 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120868762 (BCL2L1)    05202 Transcriptional misregulation in cancer     120868762 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     120868762 (BCL2L1)    05225 Hepatocellular carcinoma     120868762 (BCL2L1)    05220 Chronic myeloid leukemia     120868762 (BCL2L1)    05222 Small cell lung cancer     120868762 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120868762 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     120868762 (BCL2L1)    05162 Measles     120868762 (BCL2L1)    05168 Herpes simplex virus 1 infection     120868762 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120868762 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     120868762 (BCL2L1)    05014 Amyotrophic lateral sclerosis     120868762 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     120868762 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120868762 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120868762 (BCL2L1)    01524 Platinum drug resistance     120868762 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oda01009]     120868762 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oda03036]     120868762 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oda02000]     120868762 (BCL2L1) Protein phosphatases and associated proteins [BR:oda01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      120868762 (BCL2L1) Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120868762 (BCL2L1) Transporters [BR:oda02000]  Other transporters   Pores ion channels [TC:1]    120868762 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  120868762 NCBI-ProteinID:  XP_040103534 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacccatcttggcacttggcg gatagccctgcggtgaatggagccactggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcacccccgggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacgtttgtggaactctacgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctctttagtcggaaatga

DBGET integrated database retrieval system