Oryx dammah (scimitar-horned oryx): 120868882 Help Entry 120868882         CDS       T07255                                  Symbol OXT Name (RefSeq) oxytocin-neurophysin 1   KO K05243   oxytocin-neurophysin 1 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04024   cAMP signaling pathway oda04080   Neuroactive ligand-receptor interaction oda04081   Hormone signaling oda04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     120868882 (OXT)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     120868882 (OXT)    04081 Hormone signaling     120868882 (OXT)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     120868882 (OXT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120868882 (OXT) Cytokines and neuropeptides [BR:oda04052]  Neuropeptides   GPCR binding    120868882 (OXT) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_5 Hormone_4 Motif Other DBs NCBI-GeneID:  120868882 NCBI-ProteinID:  XP_040103749 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGRGRCFGPSICCG DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCLADPACDPEA AFSQH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcaggttccagcctcgcctgctgcctgctcggcctcctggcgttgacctccgcctgc tacattcagaactgccccctgggcggcaagcgcgcggtgctggacctcgacgtgcgcacg tgtctcccctgcggccccgggggcagaggccgctgcttcgggcccagcatctgctgcggg gacgagctgggctgcttcgtgggcacggccgaggcgctgcgctgccaagaggagaactac ctgccgtcgccctgccagtccggccagaagccctgcgggagcgggggccgctgcgccgcc gccggcatctgctgcagcccggacggctgcctcgcggatcccgcctgcgaccccgaggcc gccttctcccagcactga

DBGET integrated database retrieval system