Oryx dammah (scimitar-horned oryx): 120869481 Help Entry 120869481         CDS       T07255                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04020   Calcium signaling pathway oda04022   cGMP-PKG signaling pathway oda04024   cAMP signaling pathway oda04070   Phosphatidylinositol signaling system oda04114   Oocyte meiosis oda04218   Cellular senescence oda04261   Adrenergic signaling in cardiomyocytes oda04270   Vascular smooth muscle contraction oda04371   Apelin signaling pathway oda04625   C-type lectin receptor signaling pathway oda04713   Circadian entrainment oda04720   Long-term potentiation oda04722   Neurotrophin signaling pathway oda04728   Dopaminergic synapse oda04740   Olfactory transduction oda04744   Phototransduction oda04750   Inflammatory mediator regulation of TRP channels oda04910   Insulin signaling pathway oda04912   GnRH signaling pathway oda04915   Estrogen signaling pathway oda04916   Melanogenesis oda04921   Oxytocin signaling pathway oda04922   Glucagon signaling pathway oda04924   Renin secretion oda04925   Aldosterone synthesis and secretion oda04970   Salivary secretion oda04971   Gastric acid secretion oda05010   Alzheimer disease oda05012   Parkinson disease oda05022   Pathways of neurodegeneration - multiple diseases oda05031   Amphetamine addiction oda05034   Alcoholism oda05133   Pertussis oda05152   Tuberculosis oda05163   Human cytomegalovirus infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05170   Human immunodeficiency virus 1 infection oda05200   Pathways in cancer oda05214   Glioma oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120869481    04015 Rap1 signaling pathway     120869481    04371 Apelin signaling pathway     120869481    04020 Calcium signaling pathway     120869481    04070 Phosphatidylinositol signaling system     120869481    04024 cAMP signaling pathway     120869481    04022 cGMP-PKG signaling pathway     120869481  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120869481    04218 Cellular senescence     120869481  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120869481   09152 Endocrine system    04910 Insulin signaling pathway     120869481    04922 Glucagon signaling pathway     120869481    04912 GnRH signaling pathway     120869481    04915 Estrogen signaling pathway     120869481    04921 Oxytocin signaling pathway     120869481    04916 Melanogenesis     120869481    04924 Renin secretion     120869481    04925 Aldosterone synthesis and secretion     120869481   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120869481    04270 Vascular smooth muscle contraction     120869481   09154 Digestive system    04970 Salivary secretion     120869481    04971 Gastric acid secretion     120869481   09156 Nervous system    04728 Dopaminergic synapse     120869481    04720 Long-term potentiation     120869481    04722 Neurotrophin signaling pathway     120869481   09157 Sensory system    04744 Phototransduction     120869481    04740 Olfactory transduction     120869481    04750 Inflammatory mediator regulation of TRP channels     120869481   09159 Environmental adaptation    04713 Circadian entrainment     120869481  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120869481   09162 Cancer: specific types    05214 Glioma     120869481   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120869481    05163 Human cytomegalovirus infection     120869481    05167 Kaposi sarcoma-associated herpesvirus infection     120869481   09171 Infectious disease: bacterial    05133 Pertussis     120869481    05152 Tuberculosis     120869481   09164 Neurodegenerative disease    05010 Alzheimer disease     120869481    05012 Parkinson disease     120869481    05022 Pathways of neurodegeneration - multiple diseases     120869481   09165 Substance dependence    05031 Amphetamine addiction     120869481    05034 Alcoholism     120869481   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120869481    05418 Fluid shear stress and atherosclerosis     120869481  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oda01009]     120869481   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120869481    03036 Chromosome and associated proteins [BR:oda03036]     120869481   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120869481 Protein phosphatases and associated proteins [BR:oda01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120869481 Membrane trafficking [BR:oda04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120869481 Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120869481 Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120869481 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M FCaBP_EF-hand Caleosin MTIP_N EF-hand_11 RPN13_C SurA_N_3 EF-hand_14 SPEF2_C SurA_N_2 Dockerin_1 CDI_toxin_EC869_like Phage_portal MmeI_hel LRIM1_dimer Motif Other DBs NCBI-GeneID:  120869481 NCBI-ProteinID:  XP_040104759 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKEAFDKFDKDKDGAISVQELGTVMQELGLKPSEAELKALIARLDTDN NGIISFQEFLEAMAAGLQTSDTEEDLREIFRAFDQDDDGYISVDELRQATSQLGEKLSPD ELDAMIREADVDQDGRVNYEEFVRILTQN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtctgaagaacaggtggcggagttcaaggaggcctttgacaagttc gacaaggacaaggatggcgccatcagtgtgcaggagctgggcaccgtgatgcaggagctg ggcctgaagccatcagaggctgagctgaaggcgctcatcgcccggctggacacggacaac aacggcatcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctca gacacggaggaggacctgagggaaatcttccgtgccttcgaccaggacgatgatggctac atcagcgtggacgagctcaggcaggccacatcccagctgggggagaagctgtctccggac gagctggatgccatgatccgggaggcagacgtggaccaagatggccgggtgaactatgag gagttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system