Oryx dammah (scimitar-horned oryx): 120869503 Help Entry 120869503         CDS       T07255                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda03008   Ribosome biogenesis in eukaryotes oda03013   Nucleocytoplasmic transport oda03015   mRNA surveillance pathway oda05014   Amyotrophic lateral sclerosis oda05164   Influenza A Brite KEGG Orthology (KO) [BR:oda00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     120869503 (NXT1)    03015 mRNA surveillance pathway     120869503 (NXT1)    03008 Ribosome biogenesis in eukaryotes     120869503 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120869503 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120869503 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oda03019]     120869503 (NXT1)    03009 Ribosome biogenesis [BR:oda03009]     120869503 (NXT1) Messenger RNA biogenesis [BR:oda03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      120869503 (NXT1) Ribosome biogenesis [BR:oda03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     120869503 (NXT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  120869503 NCBI-ProteinID:  XP_040104802 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYSTMDKRRRLLSRLYMGTATLVWNGNAVSGHESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAC NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgtggacttcaagacctatgtggaccaggcgtgccgcgcagctgaggagttc gtgaacgtgtactacagcaccatggacaagcggcggcggctgctgtcccgcctgtacatg ggcacagccaccctggtgtggaacggcaacgctgtctccgggcatgagtccctgagtgag ttttttgagatgctgccttccagtgagttccagatcaacgtggtagactgccagcctgtc catgacgaagccaccccgagccagaccacggtccttgtggtgatctgtgggacagtgaag tttgagggcaacaaacagcgggacttcaaccagaacttcatcctgacggcccaggcctca cccagcaacacagtgtggaagattgccagcgactgcttccggttccaggactgggcctgc tag

DBGET integrated database retrieval system