Oryx dammah (scimitar-horned oryx): 120872127 Help Entry 120872127         CDS       T07255                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04010   MAPK signaling pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04024   cAMP signaling pathway oda04072   Phospholipase D signaling pathway oda04137   Mitophagy - animal oda04140   Autophagy - animal oda04218   Cellular senescence oda04360   Axon guidance oda04371   Apelin signaling pathway oda04625   C-type lectin receptor signaling pathway oda04810   Regulation of actin cytoskeleton oda05132   Salmonella infection oda05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120872127 (RRAS)    04014 Ras signaling pathway     120872127 (RRAS)    04015 Rap1 signaling pathway     120872127 (RRAS)    04371 Apelin signaling pathway     120872127 (RRAS)    04072 Phospholipase D signaling pathway     120872127 (RRAS)    04024 cAMP signaling pathway     120872127 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120872127 (RRAS)    04137 Mitophagy - animal     120872127 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     120872127 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120872127 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120872127 (RRAS)   09158 Development and regeneration    04360 Axon guidance     120872127 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     120872127 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     120872127 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oda04031]     120872127 (RRAS) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120872127 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  120872127 NCBI-ProteinID:  XP_040108207 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKARGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactacgacccc actattgaagactcctacacgaagatctgcactgtggatggcgtcccagcccggctagac atcctggacactgccggccaggaggagtttggtgccatgcgggaacagtacatgcgtgcg ggccacggcttcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagctcttcacgcagatccttcgagtcaaggaccgagacgacttccccatcgtgttggtt ggcaacaaggcggatctggaaacacagcgccaggtcccccgatctgaagcctccaccttc agtgcctcccaccacgtggcctactttgaagcttctgccaaactgcgcctcaacgtggat gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tccccgcccagcgcccccaggaagaaggccagaggctgcccctgtgtccttctgtag

DBGET integrated database retrieval system