Oryx dammah (scimitar-horned oryx): 120872537 Help Entry 120872537         CDS       T07255                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04024   cAMP signaling pathway oda04080   Neuroactive ligand-receptor interaction oda04081   Hormone signaling oda04935   Growth hormone synthesis, secretion and action oda04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     120872537 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     120872537 (SST)    04081 Hormone signaling     120872537 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     120872537 (SST)   09154 Digestive system    04971 Gastric acid secretion     120872537 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120872537 (SST) Cytokines and neuropeptides [BR:oda04052]  Neuropeptides   GPCR binding    120872537 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  120872537 NCBI-ProteinID:  XP_040108944 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctatcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgctggcaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system